(data stored in ACNUC7421 zone)

EMBL: CP001825.PE544

CP001825.PE544       Location/Qualifiers
FT   CDS_pept        complement(607230..607904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0550"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: regulatory protein Crp; cyclic nucleotide-
FT                   binding; KEGG: bra:BRADO3198 CRP/FNR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41468"
FT                   /db_xref="GOA:D1CEW2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW2"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACZ41468.1"
FT                   /translation="MDKSILHQLYPFSGMPQDLLRTLVNMTSYRLYAQGQLIIDLQEGR
FT                   DRTLILVSGLARVYRISTQGKELTLAKFVTGDILGLAPNDPILQPSNLLEAIADGTGIC
FT                   RVPREHFQQIIISDPEIASYCFCQLSERLGKAYDLIEEVVFMDVCTRLARTLSRLAKAN
FT                   EQRLVTATHQELAGMIGTSQEEVTRKLRHLRELGLINYQPHHRGIVVPNPDRLLSELND
FT                   LT"
     atggataaat caatcctaca tcagttatac cccttctctg gaatgcccca ggatttgttg        60
     agaactctag tcaacatgac ttcttacaga ttgtatgcac agggacaact gataatagat       120
     ctgcaagaag ggagagatag gactcttatc ctcgtcagcg gcctcgctcg agtctatcgg       180
     atttccaccc aaggcaaaga actcacccta gccaaattcg taactggtga catcctcggg       240
     cttgccccta acgaccccat actacaacca agcaacctcc tggaagcgat agcggacggg       300
     acgggaatat gtcgtgtacc gcgtgagcac tttcaacaaa tcattatctc cgatcctgag       360
     attgccagct attgcttttg tcagctcagc gagcgcctgg ggaaggcata tgacctcata       420
     gaggaggtcg tgttcatgga cgtatgcacc cgcctggcgc gcacactttc cagactggcc       480
     aaagccaatg agcaacgatt agttactgcc acccatcagg agctagctgg tatgataggc       540
     acaagccaag aggaggtcac caggaagctg cgccatctac gagaactggg cttgataaac       600
     tatcaacctc atcatcgtgg gatagtcgtt cccaaccccg accgcctcct gtccgaactg       660
     aacgatctta cctag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page