(data stored in ACNUC7421 zone)

EMBL: CP001825.PE545

CP001825.PE545       Location/Qualifiers
FT   CDS_pept        complement(608190..609083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0551"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41469"
FT                   /db_xref="GOA:D1CEW3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039967"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW3"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACZ41469.1"
FT                   /translation="MEEESNRATSIDRQESEGFDLPQEPGPEVSPSGTTPLQPSEIIRL
FT                   PTRHNPTLQKLVGIVNSDEDLHAIWRCQNVNGVDRLGMSDHGPVHVQIVANLALRLLRL
FT                   LMAKNIQPSIVKDHGMSEHDAEVVVVLAALLHDCGMSIHRDDHEFMSLFIALPKLQELL
FT                   SNLYSAAERRVIISETLHAIITHRSDGRPLTLEAGIVRVADALDMAQGRSRIPFESGHV
FT                   NIHSVSAAAIEKVEINQGQEKAIRVTIYMSNAAGIFQIDELLRQKLKGSGLETHVEVVA
FT                   QVTGESDKRLVETFKF"
     ttggaggaag aaagcaaccg agctacaagc atagacaggc aggagtcaga aggctttgac        60
     cttccccagg aaccagggcc ggaggtatcg ccttcaggca ccaccccgtt gcagccctcg       120
     gagataatca ggttgccgac aagacataat cccacgctcc agaaactagt aggtattgtg       180
     aactccgatg aggacctgca tgctatctgg aggtgccaga acgtcaacgg ggttgacagg       240
     ctgggcatga gcgatcacgg cccagtacac gtgcagatag ttgccaatct ggctcttagg       300
     ttactccgcc tcctgatggc caagaacata caaccctcaa tagtcaaaga ccacggcatg       360
     tccgagcacg atgcagaagt cgttgtggta ctggcagcac tcctccatga ctgcggtatg       420
     tccatacaca gagatgatca cgagttcatg agcctcttca tagcactacc caaactccag       480
     gagctgctca gtaacctcta ctctgcagct gaacgccgag tcatcatctc agaaaccctg       540
     cacgccatca tcactcacag aagcgatggt agacccctca ctctggaggc aggcatagtg       600
     cgagtggccg atgcgctcga tatggcccag ggcagatcca gaataccctt cgaaagtggg       660
     cacgtcaaca tccactccgt gtccgctgcc gccatagaga aggtggaaat aaaccaaggg       720
     caggagaaag ctataagggt cactatctat atgagcaacg cagcaggcat cttccagata       780
     gatgagctgc tacgtcaaaa gctcaagggc tcaggactcg agacacatgt ggaggtggta       840
     gctcaggtga caggcgagtc cgacaagaga ctggtggaga ccttcaagtt ctga             894
//

If you have problems or comments...

PBIL Back to PBIL home page