(data stored in ACNUC7421 zone)

EMBL: CP001825.PE549

CP001825.PE549       Location/Qualifiers
FT   CDS_pept        complement(612901..613890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0555"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="KEGG: gbm:Gbem_4017 galactose-1-phosphate
FT                   uridylyltransferase; TIGRFAM: galactose-1-phosphate
FT                   uridylyltransferase; PFAM: galactose-1-phosphate uridyl
FT                   transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41473"
FT                   /db_xref="GOA:D1CEW7"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW7"
FT                   /inference="protein motif:TFAM:TIGR00209"
FT                   /protein_id="ACZ41473.1"
FT                   /translation="MSELRWHPLLREWVITATHRQDRTFLPPRDYCPLCPTKSGKHETE
FT                   IPVETFDIAVFENKFPSLQRQPPQPAIEPMGIFDVRPAEGVCEVVVYTPEHDTTLTDQS
FT                   VSHIRRLIAVWRDRYIELGSLPYVKYVFIFENKGEVIGVTLHHPHGQIYAYPFIPPLMQ
FT                   RELSALSEHRAKTGRCLVCDVLQQETNYGKRILFEEGNFVAFIPFYARWPYEVHIIPRR
FT                   HFGSLAEITSEESWDLAYALKRVLVGYDKLFGFSMPFIMALHQTPTDDQEHPYYHFQLQ
FT                   FYPPHRTSTKLKYLAGSETGAGTFINDSLPEEKAPELRAVIPDKESIE"
     atgtctgagc tcagatggca tccgctactc agggaatggg tgatcacagc cacacacagg        60
     caggacagaa cttttctccc tccaagggat tactgcccgt tatgccctac taagagtggc       120
     aagcatgaga cagaaattcc agtggagact ttcgatatag cggtcttcga gaacaagttc       180
     ccatcgttgc agaggcaacc accgcaaccg gcgatagagc ctatggggat cttcgatgtg       240
     cggcctgcag agggtgtgtg tgaggtagtg gtatatactc cggagcatga caccacactt       300
     accgaccaga gcgtgagcca cattcgccgc ctgatagctg tctggcgcga tcgttacata       360
     gagcttggta gcttgcctta cgttaagtac gtgttcattt ttgagaataa gggagaggta       420
     ataggtgtga ccttgcacca tccgcatggt cagatctatg catacccttt catccctccc       480
     cttatgcaaa gggaattaag tgctcttagc gagcatcggg cgaagacggg aagatgcctg       540
     gtgtgcgatg tcctgcaaca ggaaactaac tatggcaaaa ggatactctt tgaggaaggc       600
     aactttgtag cgtttatccc cttctatgcg cgctggccat atgaggtgca tataattccc       660
     aggaggcatt tcggatccct ggctgagata acgagcgaag aatcctggga tctagcttat       720
     gccctcaaga gagtacttgt tggatacgac aagctgttcg ggttcagcat gccgtttata       780
     atggccctgc accagacacc tactgacgac caagagcatc cttactacca cttccagtta       840
     cagttctatc ctccacatag aacctctacc aagctcaaat atcttgcggg tagtgaaact       900
     ggagcaggga ctttcatcaa tgactccctg ccagaggaga aagctccaga actcagggca       960
     gtcataccag ataaggagag cattgaatga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page