(data stored in ACNUC7421 zone)

EMBL: CP001825.PE551

CP001825.PE551       Location/Qualifiers
FT   CDS_pept        614228..614605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0557"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: bra:BRADO3246 sensor histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41475"
FT                   /db_xref="GOA:D1CEW9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEW9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ41475.1"
FT                   /translation="MVCSVAKGRILLVEDSLPTLLFLSDVLEDEGYEVKALSESSEVLK
FT                   VVGEFMPDVIISDINMPAIDGVTLSSIVRRSFPDLPIILCSATRPKPRQQHILDKLQHC
FT                   YFRIKPLCVQELLSLLEKLVE"
     ttggtttgca gcgtggccaa gggaaggatc ttactggtcg aggacagtct ccccacactc        60
     cttttcctgt cggatgtgct ggaggatgag gggtacgaag tcaaagcgtt atcagagagc       120
     agtgaagtat tgaaagtggt cggggaattt atgcccgacg tgatcatttc ggatataaat       180
     atgcctgcga tcgacggcgt cactctctcc tccatagtga gaaggtcttt tccagacctg       240
     ccgataatac tatgctcggc aaccaggcct aagccccgac agcagcacat actggacaag       300
     ctacagcact gctactttcg aatcaagcct ctgtgtgttc aggagcttct atctctgctg       360
     gagaagcttg tcgagtaa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page