(data stored in ACNUC7421 zone)

EMBL: CP001825.PE552

CP001825.PE552       Location/Qualifiers
FT   CDS_pept        614701..615780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0558"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: lch:Lcho_3206 oxidoreductase domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41476"
FT                   /db_xref="GOA:D1CEX0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX0"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ41476.1"
FT                   /translation="MDKLHIGIIGVGWPGQRHIEGYKRREDVEIVAVSDVNTELAQQIV
FT                   DQYDLKAQIYADYHEMLQSANVDAVSICTPNFLHAPMAIDALDAGKHVLLEKPLAHNLE
FT                   SGIKIAQKVKETGLVFMIAFNNRFRPDSKLLKARIEEGLLGEIYYAKTGWLRGAAEFFL
FT                   RGWFTQKEKSGGGPLIDLGVHMLDLALWFMGNPRPVSVSGSVYYKFTDVMKASAGQADV
FT                   EDLSTAFVKLDNGGTIVLDVSWISHIKNPDEVYCQLFGTKGGAKIDRHTGTEDLDIYTV
FT                   VDGVTVLQKPEFNTWRQRQPGYMLYESFAGETSHFVDCVRENKQPESNIQHGLDVLRVL
FT                   DAIYKSAESGHEVIIDTNL"
     atggataagt tgcacatagg tatcattggt gtgggttggc ctggtcagcg gcacatagag        60
     gggtacaaga gacgtgaaga tgtcgagata gtagctgtat ctgatgtcaa cacagaactg       120
     gcccaacaga tagtggacca gtacgacctg aaagctcaga tctatgcaga ctaccacgag       180
     atgctgcagt cagccaatgt agatgccgtg agcatctgca ctcctaattt cctccatgcg       240
     cctatggcta tcgatgccct ggacgctggt aaacacgtgc tgcttgaaaa gccattggcg       300
     cataatctgg agtcggggat caagatagct cagaaggtca aggaaactgg cctagtcttt       360
     atgatcgcct tcaacaacag gttcaggcca gacagtaaat tgctcaaggc acgcattgag       420
     gaagggctgc tgggtgagat ctactatgcc aagaccggct ggctgagggg ggcagctgaa       480
     ttcttcctta gaggatggtt cactcagaag gaaaagtccg gtggtggacc tctcattgac       540
     ctcggagttc atatgcttga cctcgccctc tggtttatgg gtaatcctag acctgtaagt       600
     gttagtgggt ccgtctatta caagttcaca gatgtgatga aggcaagcgc tgggcaggca       660
     gacgtggaag atctatccac agcttttgta aagctggata acggcggcac gatagtgctt       720
     gatgtcagct ggatatcaca tatcaagaac ccggacgagg tatattgcca gctgtttggc       780
     accaagggtg gtgcaaagat agatcgtcat acaggcaccg aggacctgga catatatacc       840
     gttgtagatg gtgttaccgt gctccagaaa ccagagttca acacgtggcg ccagaggcag       900
     cctggatata tgctctatga gtcctttgca ggggagacct ctcacttcgt ggactgtgtc       960
     agggagaaca agcagcctga atctaacatc cagcatggct tggatgtgct acgtgtgctg      1020
     gacgctatat acaagtctgc tgagagcggg catgaggtca ttatagatac taacctctaa      1080
//

If you have problems or comments...

PBIL Back to PBIL home page