(data stored in ACNUC7421 zone)

EMBL: CP001825.PE553

CP001825.PE553       Location/Qualifiers
FT   CDS_pept        615833..616492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0559"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: rpc:RPC_0982
FT                   peptidase C56, PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41477"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX1"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACZ41477.1"
FT                   /translation="MTLSGQRKIILLAADGVHENEVLSIRERASAAGMNLVIASLTGAA
FT                   LQSVNGLDKGQLLEPDMAVDQVKPEDYDALVIPDGLYSVDALRGNTLVIEIVTKFLEEG
FT                   KPLGVIGHAPWILIESGLVTNRSLSSWHTLRVDILNAGGHWVKSPVHNDMALVSAASSD
FT                   YIEDFLDRFISEVQSGVHTSRGAAPGKDKVLESSEESFPASDAPGWVSSSEREEES"
     gtgactcttt ccgggcagag aaaaataatt ctactggcgg ccgatggcgt ccatgagaac        60
     gaagtgctca gtataaggga aagggcgtct gctgcgggga tgaatttggt catagcctct       120
     ttgactggtg ctgcgctaca gtcggtaaat ggactcgata aaggacagtt gctagaacct       180
     gatatggctg ttgaccaagt caagccggaa gactatgatg ctttggtcat acctgatggt       240
     ctgtattcag ttgacgctct gagaggcaac acgctagtga tcgagatagt aaccaagttt       300
     ctggaagaag gtaaaccctt gggagttata ggccatgctc cctggattct aatagaatca       360
     ggacttgtca ctaatcgctc tctgtcatcc tggcacactc tcagggtcga tatactgaat       420
     gcgggcggac actgggtgaa atccccagtt cataacgata tggcgctggt gagcgctgct       480
     tcttccgatt atatagagga ctttctggac agatttatca gtgaagtcca gtccggcgtg       540
     catacctcca gaggagcagc tcctggcaag gacaaggtcc tggagtcatc ggaggagtcc       600
     ttccctgcaa gcgatgctcc cggctgggtg tcgagttcag agagagagga ggagtcgtag       660
//

If you have problems or comments...

PBIL Back to PBIL home page