(data stored in ACNUC7421 zone)

EMBL: CP001825.PE554

CP001825.PE554       Location/Qualifiers
FT   CDS_pept        complement(616503..618005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0560"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: aba:Acid345_1459
FT                   aldehyde dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41478"
FT                   /db_xref="GOA:D1CEX2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX2"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACZ41478.1"
FT                   /translation="MREYMNYIDGKWVPSSTGETFKSINPANGEVVAVLAKSSREDVDK
FT                   AVQAARRAFDKWRLYPAPRRGEILYEVGRILKERKEDLARLMTQEMGKVLTEARGDVQE
FT                   GIDMAFYVGGEGRRLFGVTTPSEMPNKFQMAVRDPVGVVAAITPWNFPIAIPTWKLMPA
FT                   LVAGNTVVFKPASDTPALGAELVKIFEEAGLPPGVLNLVTGTGEEVGKALLEHPGVDVI
FT                   SFTGSTDTGSQVLTQTASKNKKISLEMGGKNAITVMDDADIDLAIEGILWSAFGTTGQR
FT                   CTACSRLIVHKSIRDTLTEKLLSRIQNLRLGDGLDPETDVGPVINERQLNKIHQYVGIG
FT                   REEGAKLLIGGDRATDGELSKGFFYKPTLFTDVDPNMRIAQEEIFGPVLSMITVNSLEE
FT                   AIKVNNCTKYGLSSSIYTRDINKAFRAMRDFNTGIVYINHGTIGAEVHLPFGGTKGTGN
FT                   GHREGAVWAALDVFTEWKSVYIDFSGRLQRAQIDIDKINIES"
     atgagagagt acatgaacta catcgacggc aagtgggtac cttcatccac aggggaaacc        60
     ttcaagagca taaaccccgc caatggggaa gtggtagcgg tcctggccaa gtcttccaga       120
     gaagacgtag ataaagcggt acaggcggcg cgcagagcct tcgataagtg gaggctatat       180
     cctgcaccta gacggggaga aatactctat gaggtcggtc gcatcctgaa agaacgcaaa       240
     gaagatctgg ccagacttat gactcaggag atggggaagg ttctgacaga ggctagggga       300
     gacgtgcagg aaggcataga tatggccttc tacgtgggtg gagagggcag gaggctcttc       360
     ggcgttacca ctccttcgga gatgcctaat aagtttcaga tggcagtcag ggacccagtg       420
     ggcgtcgtag cagctataac tccctggaac ttcccgatcg cgatccctac gtggaagctt       480
     atgccagcgc tagtggccgg caacaccgta gtgtttaaac cggcttctga tacccctgcg       540
     ctgggggctg agctggtaaa gatctttgaa gaggcggggc tacctccagg tgtccttaat       600
     ctagtgacag gtacaggaga agaggtaggt aaggccctgc ttgaacatcc cggtgtggat       660
     gtaatctcgt tcaccggatc cactgacact ggctcgcagg tactaacaca gactgctagc       720
     aagaacaaga agatcagcct ggagatgggc ggcaaaaacg cgataactgt gatggatgac       780
     gcagacatcg atctggcgat tgagggcatt ctctggagcg cttttggcac cactggtcag       840
     agatgtacgg cctgtagccg actgatagtt cacaagagca tacgagacac gcttacagag       900
     aagcttctgt cccgcatcca gaatctgcga ctgggagacg ggctggatcc agaaacagat       960
     gttggcccag tcatcaatga gaggcaactc aacaagattc atcagtacgt aggtatcggc      1020
     agggaggaag gagcaaagct tctcattggc ggggatagag ctacagatgg agaattgagc      1080
     aagggcttct tctataaacc cactctattt acagatgttg accctaacat gcgtatagca      1140
     caggaagaga tatttgggcc ggtactctcg atgataaccg tcaacagcct tgaggaagcc      1200
     ataaaggtaa acaattgcac gaagtatggg ctctccagct ctatctatac tagagatatc      1260
     aacaaggcat ttagagccat gcgcgacttt aatacaggta tcgtctacat caaccacggt      1320
     actatagggg cagaagtgca cctgcctttt ggaggcacca aaggtacagg gaatggacat      1380
     agagagggag ccgtatgggc tgcgttggat gtatttaccg aatggaagtc tgtctatata      1440
     gacttcagcg gcaggctgca gagagcacag atagatatcg ataagataaa tattgagtcg      1500
     tag                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page