(data stored in ACNUC7421 zone)

EMBL: CP001825.PE555

CP001825.PE555       Location/Qualifiers
FT   CDS_pept        618130..618879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_0127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41479"
FT                   /db_xref="GOA:D1CEX3"
FT                   /db_xref="InterPro:IPR011578"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41479.1"
FT                   /translation="MRRRRKSRFANSMEERFAAILDLLRLRWQYEPHTFVLRRRFDGSP
FT                   MVAFTPDFYLEEFDLYVELTMHKRRLVTLKNRKVRLMREKYPEHNIRLLYLHDCLSLIR
FT                   PVRSYKEREKVLRRLIPWASQEHYDRVRWHRRLVRRVSSSGRVHFLGKVLSLGADWAGK
FT                   ECIIWVYSDHLDIEIEGRTIASLECAYDNRKDKLLQVQSKVLIDNEPLEGNLLPAGRRI
FT                   LSLVQEDTGNASHGLVRCYAQASFQLF"
     atgagacgaa ggcgtaagtc gcgctttgca aactcaatgg aagagaggtt tgccgctata        60
     ttggatctcc tgcgccttcg gtggcagtat gaacctcaca cattcgtcct ccgccgcaga       120
     tttgatggat ctcctatggt agcctttacg cctgactttt accttgaaga gttcgatctc       180
     tacgtggagc tcaccatgca caaacgtaga ttggtaactc tgaagaaccg gaaggtcagg       240
     ctaatgcgtg agaaataccc ggagcataac atcaggttgc tttatctgca cgactgtctg       300
     tctctaatcc gacctgtgag atcctacaag gagagggaga aagtccttcg taggcttatt       360
     ccctgggcat cccaggagca ctacgatcgc gttaggtggc acaggaggtt agttaggcga       420
     gtatcatcat ctggacgtgt ccacttcctg ggtaaggttc tgtctttggg ggcagattgg       480
     gcgggcaagg aatgcattat atgggtctat tcggaccacc tggatataga aattgagggc       540
     aggacaatag cctctctgga atgcgcatac gacaatcgca aggataaatt actgcaagtc       600
     cagtctaagg tccttataga taatgagccc ctggagggta atcttctccc cgcaggtaga       660
     agaatcctat ccctagtgca agaggatacg ggcaatgcga gccatggctt ggttcgctgc       720
     tacgcacagg ccagctttca actgttttag                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page