(data stored in ACNUC7421 zone)

EMBL: CP001825.PE561

CP001825.PE561       Location/Qualifiers
FT   CDS_pept        624614..625579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0567"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; SH3 type 3
FT                   domain protein; KEGG: sfr:Sfri_1626 sortase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41485"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEX9"
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /protein_id="ACZ41485.1"
FT                   /translation="MSKIRIFNASFWLIFVMAFSFFINACGGNANSSAGIPSPTARSQE
FT                   VVASSPTPAPSPSVYEATQPTPTADGVVASPSPTPAQASPANTPPKESSTKYTRTMYVD
FT                   GIREGYVGVNLRARPSTESQSLLVIKNREPVRTTKGPMQGADGNLWFPASYNGKEGYIL
FT                   ATLLSAQRPAPPPVRLIIKNDRLDVDAAVEYVGLTPDGAMDVPKKWEDVAWYRLGPVPG
FT                   QQGNAVIAGHLDSTTGPAVFWKLKDIRIGDVVSVIDEDGHKINFKVTKIQSYFDEDAPL
FT                   YDIFGPTDKSRLNLITCDGSWDPKAKRYDKKLVVFTEKIS"
     atgtctaaga ttaggatctt caatgccagc ttctggctta tttttgtaat ggcgttctct        60
     tttttcataa atgcttgtgg tgggaatgct aacagcagtg ctgggatacc atctcccact       120
     gccaggtcgc aggaagtcgt tgcttccagc ccaacccctg ccccgtctcc atctgtctat       180
     gaagctactc agcctacacc tacggctgac ggggttgtgg ccagtccttc tcctacgcct       240
     gcacaagcca gcccagctaa cactccacct aaagagtcaa gcaccaaata cactcggacg       300
     atgtatgttg acggcattcg ggaaggatac gtgggtgtca atctcagggc cagaccttcc       360
     accgaatcac agtccttgct agttatcaag aacagagagc cggttagaac caccaagggc       420
     cctatgcaag gagccgatgg caacctgtgg ttccctgcaa gctataatgg taaggaaggg       480
     tacatattag ccacgctgct tagcgcacaa agaccagccc cccctccagt gcgcctaatc       540
     ataaagaatg acaggttgga tgtagatgct gccgttgagt atgtggggtt gactcctgat       600
     ggggccatgg acgtgcccaa gaagtgggag gatgttgcct ggtatcgttt gggtccggtc       660
     ccaggtcagc aaggtaacgc agtaatagca ggtcacctgg attccaccac cggtccggca       720
     gtattctgga agctgaaaga catcaggata ggagatgtgg tgtccgtaat tgacgaagat       780
     ggacataaga ttaacttcaa agtcacgaag attcagtcct actttgacga ggacgcacct       840
     ctgtacgata tatttggccc cacagataag tcgcgcctga accttatcac ttgtgatggc       900
     tcatgggacc cgaaggctaa gagatatgac aagaagctgg tggtgttcac cgagaagatc       960
     agttag                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page