(data stored in ACNUC7421 zone)

EMBL: CP001825.PE562

CP001825.PE562       Location/Qualifiers
FT   CDS_pept        complement(625597..626898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0568"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: bha:BH2135 glycolate oxidase
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41486"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEY0"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACZ41486.1"
FT                   /translation="MCPSSNTLQSWDELDPPAYDIINACVQCGLCLSVCPTYLLTFKET
FT                   SSPRGRIHLLKAVWEGKLDARDPILDHQMYECLDCRACEAICPSGVRYGVLVESARAQL
FT                   ERKHPRSLWVRALRWIVFNKLFASMALFRAFSRALWLYQRIGLSRIARSTRILDILHLA
FT                   DKEALLPQIPSKFFVPEDQALPPKGNKRFRVGLFAGCIMSTAFAEIDRATIRVLQHNGC
FT                   EVVVPKRQGCCGALNVHSGERRSATEMMKANIQAFERLDLDYIIVNSAGCGATLKEYPH
FT                   FFKDDPGWHERAKHFSSLVRDVSEFLSEVGMSGPNRAVPVRVTYQDPCHLAHAQKVYRQ
FT                   PRELLASIPGVELVEMQESKLCCGSAGIYNITNPEISNQLLERKLEHALATGAEVIVSA
FT                   NPGCMLQLQKGLRHRGLDIQVKHLVQILDQAYGD"
     gtgtgtcctt cgagtaatac actacagagc tgggatgaac tcgacccccc agcatacgat        60
     ataatcaacg catgcgtcca gtgcggcctc tgtttgtcgg tatgtcccac ctacctgctc       120
     actttcaaag agacttcttc tccgagaggg agaatccact tattaaaggc cgtatgggaa       180
     ggaaaacttg acgccagaga tccaatcctg gatcaccaaa tgtatgaatg cctagactgt       240
     agggcctgcg aggccatatg tccctccgga gtcagatatg gggtgctggt agagtcggcc       300
     agagcacagc tggaaagaaa gcatccacgt agcctttggg tgagagctct gagatggata       360
     gtgtttaaca agttgtttgc aagcatggcc ctattcagag catttagcag ggccctctgg       420
     ctataccagc gtataggact ctcgcgtata gcgaggtcga cgcgcatact ggatatactc       480
     catcttgctg acaaggaagc attactgcca caaatccctt ccaagttctt tgttccagag       540
     gaccaagcat taccacctaa gggtaacaag aggttcaggg ttgggttatt tgcaggatgc       600
     atcatgagca ccgcctttgc ggagatagac agggcaacga tacgagttct acagcacaat       660
     ggctgtgagg tcgtagtccc gaagaggcag ggatgctgtg gcgctctcaa tgtgcactct       720
     ggagagagaa ggagcgccac cgagatgatg aaggccaaca tacaagcctt cgaaagactt       780
     gatctcgatt acataatcgt gaactctgca ggctgtggag caacgctcaa agaataccct       840
     cacttcttca aggacgatcc tgggtggcac gagcgagcaa agcatttctc atcacttgtc       900
     cgagacgtaa gcgaattcct gagtgaggtg ggcatgagcg gccctaatag agctgtgcct       960
     gtaagagtta cttatcaaga cccatgccac ctggcgcatg ctcagaaagt atacagacaa      1020
     ccacgagagc tgctggcttc catacccgga gtagagctgg tggagatgca ggaatccaaa      1080
     ctctgttgcg gtagcgccgg catatataac atcacgaatc ctgaaatttc aaaccagctg      1140
     ctggaaagga agctggaaca tgcactagct acaggtgcag aggtcatagt gtccgctaat      1200
     cccggatgca tgctccagct gcagaaagga ctccgccacc gcggactcga catacaggta      1260
     aaacacctgg tccagatcct ggaccaggct tacggtgatt ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page