(data stored in ACNUC7421 zone)

EMBL: CP001825.PE563

CP001825.PE563       Location/Qualifiers
FT   CDS_pept        626973..627941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0569"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: pat:Patl_3506 inosine/uridine-preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41487"
FT                   /db_xref="GOA:D1CEY1"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEY1"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ACZ41487.1"
FT                   /translation="MKVIIDCDMGIDDAIAVAYALALQDVDVLGIGSVHGNIEADVAAE
FT                   NTLKLLKVMNRTDIPVAVGAPKPMIRPLSMAKFVHGEDGLGNANFAPSGLVPSDEHAAD
FT                   QIIRLARENPGEITLITTGPLTNAAIALLKEPKLPQLIPHVVVMGGTVEHPGNVGPVSE
FT                   ANIAHDPEAAQIVFSAPWKVTMVGLDVTMKTLLLEQHLDAWKQARTPLTEWLLRIVPFY
FT                   MQFYSQSLGYMACAMHDALAVGIAVGKVEVSESVTCPVWVNTVVGPGLGQTVADRRSES
FT                   MRATSEPYYFIGESNTEVIMKVDGDAFVSHLVDSIASYQVR"
     atgaaggtca tcatagattg cgacatgggc atagacgatg ccatagccgt ggcttatgct        60
     ctggctcttc aggatgtaga tgtgctaggt atagggtcgg tccacggcaa cattgaagcc       120
     gatgtggcgg ccgagaatac gctcaaactg ctcaaggtca tgaacaggac cgacattccg       180
     gtagcggtgg gtgcgcccaa accgatgata agacctctct ctatggccaa attcgtacat       240
     ggtgaggatg gcttgggtaa tgcaaacttt gcaccttcag gactggttcc ttctgatgag       300
     catgcagcag atcagataat caggcttgct cgtgaaaatc caggagagat cacccttata       360
     accactggac ctctgacaaa tgccgccata gcgcttctca aggagcctaa gctgcctcag       420
     ctaatacctc atgttgtggt gatgggagga accgtagagc acccaggcaa cgtcgggccg       480
     gtatcagaag ccaacatagc tcatgaccca gaggctgcac aaatagtatt tagcgcccct       540
     tggaaggtca ctatggtagg gctggatgtt accatgaaga ccttgctcct agagcaacat       600
     ctagatgcat ggaagcaggc tagaacgcct cttaccgagt ggctactacg tatagtaccg       660
     ttctatatgc agttctactc gcagtcgcta ggatacatgg cttgcgctat gcatgatgcg       720
     ctcgcagttg gtatagctgt tggtaaagtc gaggttagcg aatcggtgac ttgtccagtg       780
     tgggtgaaca cggtggttgg tccgggcctt gggcagacgg tagccgatag aaggtcagaa       840
     agcatgcgag cgacttcgga accttactac tttatcggtg agtctaacac agaggtgatc       900
     atgaaggtgg atggcgatgc atttgtgtca cacctggtgg attctattgc atcttatcaa       960
     gtaagataa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page