(data stored in ACNUC7421 zone)

EMBL: CP001825.PE565

CP001825.PE565       Location/Qualifiers
FT   CDS_pept        complement(629187..629555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_1829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41489"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEY3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_1829"
FT                   /protein_id="ACZ41489.1"
FT                   /translation="MKVAYIFSTSGHTVSYKLGKMILPQLEEDRHGAEVIGMFFFDDNT
FT                   YMLRKGDPVGERLSKVAKDKGIMLMLCDQCAVERGLAEIGPDGKCYPKDVVEGVQVGCF
FT                   PDLYAALGNNPPDQVITL"
     atgaaagtag cctacatatt cagcacaagc ggccatactg tcagctataa gttggggaag        60
     atgattttgc cgcagctcga ggaagatcga cacggcgccg aggtcatcgg tatgttcttc       120
     tttgatgaca acacatatat gcttcgaaag ggtgatccgg taggggagag actctccaaa       180
     gtcgcaaagg ataagggcat aatgctgatg ctctgtgacc agtgcgctgt agagcgagga       240
     ctagctgaga tcggaccgga cggcaagtgc tacccgaagg atgtggtgga gggagtacag       300
     gtaggttgtt tccccgatct atacgcggcc ttgggaaata acccacccga ccaggtcatc       360
     actctataa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page