(data stored in ACNUC7421 zone)

EMBL: CP001825.PE566

CP001825.PE566       Location/Qualifiers
FT   CDS_pept        complement(629818..630768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0572"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: abo:ABO_0508 D-isomer specific
FT                   2-hydroxyacid dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41490"
FT                   /db_xref="GOA:D1CEY4"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEY4"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACZ41490.1"
FT                   /translation="MEKIEIIANSAIIERFGDQIRSVDQAIELIPIEKALSEDSIHPQV
FT                   LIRSEIPNDLLVQILDKFASIRWVHSYSAGVEGLIPILQHRDLVLTNSAGLHGEPIAEW
FT                   VIAMTLAHAKRFHLLFRHFQAHEWQAEECDELGGKTMVIVGAGGIGASIARRAKCLGMK
FT                   VVGVRSSGRSSEHFDEMLTSDSLHAALGKGDYVVIATPLTPQTQGMIGESELRAMKSSS
FT                   VLLNIARGKIVQTEALMKALSEGWIAAAYLDVTDPEPLPPDHPLWSTPNVFITAHTSGY
FT                   SPYSAERLVRFFCDNLKRWLQGEPLLNQVDLSRGY"
     ttggagaaga tcgagataat cgctaactca gcaatcatcg agaggtttgg cgatcaaatc        60
     agatccgtgg atcaagccat agagcttata cccatcgaaa aggccttgag cgaggatagt       120
     atccatccgc aggttctaat taggtctgag attcccaacg atctactagt tcaaatcctg       180
     gacaaatttg catctatcag atgggttcat agctacagcg ccggtgtgga aggacttata       240
     ccaatcctcc aacatcgaga cctggtgttg accaacagtg ctgggctgca tggtgagcct       300
     atagcagagt gggttatagc tatgacactg gcacatgcta aaagattcca cctcctgttt       360
     agacactttc aggcccatga atggcaggcg gaggaatgcg atgagctcgg cggtaagaca       420
     atggtaattg taggggctgg agggatagga gcttcgatag cacgtagggc gaaatgcctg       480
     gggatgaaag tcgtgggcgt aagatcaagc ggcaggagct ctgagcactt tgatgaaatg       540
     ctaacatctg acagtctgca tgcagcgcta gggaaaggtg actatgtagt catagctact       600
     cctcttacgc cccagactca aggcatgata ggcgagtctg aactcagagc aatgaagagc       660
     tcttccgtgc tgctaaacat agctcgagga aagatagtgc agacagaagc actcatgaag       720
     gctttgtccg aaggctggat agcagcagcg tatttggatg tgactgaccc tgaacccctg       780
     cctccggatc atccactgtg gtccacccct aacgtcttca tcacagctca tacctcagga       840
     tattcaccat attcggctga gcgactagtg agattctttt gcgataatct gaaacgctgg       900
     ctgcaagggg agccactact taaccaggtt gatctgagcc gaggctacta g                951
//

If you have problems or comments...

PBIL Back to PBIL home page