(data stored in ACNUC7421 zone)

EMBL: CP001825.PE57

CP001825.PE57        Location/Qualifiers
FT   CDS_pept        complement(59592..61076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0058"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="3.5.1.4"
FT                   /note="KEGG: gbm:Gbem_3644 glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40981"
FT                   /db_xref="GOA:D1CDH5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDH5"
FT                   /inference="protein motif:TFAM:TIGR00132"
FT                   /protein_id="ACZ40981.1"
FT                   /translation="MKHRDNRDLVDLSIRELRKLLDNKHVSSVELTEAYLRRIEQVDPQ
FT                   IRSYLTVTADLALQQAQEADKKLASGEKSPLLGIPMALKDIISTKGIKTTCGSKMLENY
FT                   IPPYDATVYEKLCAAGCVLLGKLNMDEFAMGSSTENSAYGPTKNPWDLTTVPGGSSGGS
FT                   ASAVAAGEAAFTLGSDTGGSVRQPAALCGVVGLKPTYGRVSRYGLVAFASSLDQIGPIT
FT                   RTVEDLADVLQVIAGYDPKDSTSVPIDVPQYGDALSEDIRGIRIGVPKEYFVEGMEPGV
FT                   ERAVREAIDKLGSLGAKIVDISLPSTDYALATYYIIAPAEASSNLSRYTGVEYGHRAPD
FT                   AEDIIDMYMKTREEGFGPEVKRRIMLGTYVLSAGYYDAYYLKAQKVRTIIKSEFDAAFK
FT                   ECDVIATPTSPTVAFKLGSKLQDPLSMYLSDLFTIPANMAGIPGLSIPCGFSDDLPVGL
FT                   QLLGKAFDESTLLKVGYAYQQSTEWHLKRPQILAYL"
     atgaaacata gagataatag agatttggta gatctgagta ttagagaact tagaaagctt        60
     cttgataata agcatgtaag ctctgtagaa cttacagaag cttaccttag aagaatagaa       120
     caagttgatc ctcagatcag atcttaccta actgttactg cggacttagc tcttcagcaa       180
     gcccaagagg cagataaaaa gctggcttct ggggagaaat cccctctgct aggtatcccc       240
     atggccctaa aggacataat atctacaaag ggcataaaga ccacttgtgg ttctaagatg       300
     cttgagaact atataccccc atatgatgcc acagtttacg aaaagctatg cgcagctggc       360
     tgtgtgctat tgggcaagct gaatatggat gagttcgcca tggggagcag tactgagaac       420
     tctgcttatg gccctacaaa aaatccttgg gatcttacaa ctgttcccgg cggtagcagt       480
     ggaggttctg cctcggcggt tgcagcaggc gaggcagctt ttactctagg ttcagataca       540
     ggtggaagtg tcaggcaacc agctgcattg tgtggtgtag tgggacttaa acctacgtat       600
     ggtagggtgt ctcgctatgg tcttgtggct tttgccagct ctcttgatca gataggtcct       660
     atcacaagga cggtagaaga tctggccgat gtgttacagg ttatagctgg ttatgatccc       720
     aaagattcta ctagtgttcc aatagatgtt cctcagtatg gggatgcatt gagtgaggat       780
     attagaggta taagaatcgg agttccgaaa gaatactttg ttgaaggcat ggagcctgga       840
     gtagaaaggg ctgtaagaga ggccatagat aagcttggat cattaggagc taaaatagta       900
     gatatatctc tacctagcac tgattacgct ctagctacgt attacatcat tgcccctgcc       960
     gaagcatcgt cgaacttgag cagatataca ggggtggagt atggtcatag ggctcctgat      1020
     gctgaagaca taatcgatat gtatatgaag actagagagg aaggcttcgg ccctgaggtt      1080
     aagaggcgta tcatgcttgg tacttatgtg ctgtccgctg gttactatga tgcctattac      1140
     ctcaaagctc agaaggttcg aactattatc aaatcagagt ttgatgcggc attcaaggag      1200
     tgtgatgtta tagcaactcc tacaagccct acagtagcct tcaagcttgg atccaagtta      1260
     caggacccat tatccatgta cctatctgac ctgtttacga ttcctgctaa catggctgga      1320
     ataccaggct taagcatccc ttgtgggttt agtgatgatc taccagtggg actccagctt      1380
     cttggtaagg cttttgatga atctacacta ctgaaagtgg gttatgccta ccaacagagc      1440
     accgagtggc acttgaagcg tccgcagatc ctggcttact tatag                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page