(data stored in ACNUC7421 zone)

EMBL: CP001825.PE6

CP001825.PE6         Location/Qualifiers
FT   CDS_pept        4723..6393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0006"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: met:M446_3854 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40930"
FT                   /db_xref="GOA:D1CDC4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC4"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ACZ40930.1"
FT                   /translation="MSRDKDYDVIVIGAGHNGLVCANYLAKAGCKVVVLERRPVVGGAS
FT                   ATEEMFGGYKIDVGSAVHTLIHETGIIDDLKLEKFGLKYLQLDPFAFAPFPDGTYLRFY
FT                   RDLDKTCEEIEKVSPKDAEAYKKFVEDWTELNRILTATFTSKPSAPSMSYKALSKDIVS
FT                   LLKMTARRSLQDRIHQLLMDYGKLLSMTFESEYVKAPLAFLAAQAGVSPSTPGTANFAG
FT                   WHALSHSTGVTRPQGGSGKLSEALQESLINMGGEVRLDTEVTSILIRNDRAIGVETSSR
FT                   EKFSSDIVISSVAPVKTLLELIPSEALNDNLRRKISSIKISPISGVYIRGIATNLPEYK
FT                   AVGGSDNKDHYMGMQLLCPTLSGLEKGFQEATIGNKPSKPAVYLLTPSVVDPSLAPEKH
FT                   LVYIWAQPYPLQLAGGQSWDDATQDVVADIFNATSEYIEGLVDIITKHRVIRTPPQLAG
FT                   DLQLPYSNIMHGDMTIDQLFFMRPIPELSGYRTPIKGLYLTGAGTHPGGGVQGAAGKNT
FT                   AEVILADMTKAKRWIKPALVVAGSSIAFAVLRRSARASN"
     atgagcaggg acaaagacta cgatgtcatc gttataggag cgggacacaa tggcctagtg        60
     tgtgcaaact acctggccaa agccggctgt aaagtagttg tcctggagag aaggccagtc       120
     gtgggtgggg catcagccac tgaagagatg tttggagggt acaagatcga tgtaggcagc       180
     gctgtccaca cattgattca cgagacaggc atcatagatg atctcaagct tgaaaagttt       240
     ggactgaaat atttgcagct cgatcccttc gcattcgcac ccttcccaga tggcacgtac       300
     ctgcgtttct acagggattt ggacaagacg tgcgaggaga tagagaaagt atctccaaag       360
     gatgcagagg cttacaagaa gttcgtagaa gactggacgg agctgaatcg tatccttaca       420
     gctaccttca catcaaaacc atcagccccg agtatgtcct acaaagccct atcaaaagat       480
     atagtgtcct tgctgaagat gactgcaaga agatccttgc aggacaggat acaccagtta       540
     cttatggact acggcaagct gctatctatg acttttgaga gcgaatatgt taaagccccc       600
     ttggcttttc ttgctgcaca ggctggagta tctccaagta ctcccggaac ggccaacttc       660
     gcggggtggc atgcactgag ccactctacc ggcgtaactc gtccccaagg aggttctggc       720
     aagctatcag aagctctaca agaatcttta atcaatatgg gtggagaggt acgtttagac       780
     accgaggtca ccagcatact tatcaggaac gacagagcta taggggtaga gacttcttcc       840
     agggagaagt tttcctccga tatagttata agctcagttg ctcccgtcaa gaccctattg       900
     gaactcatcc catccgaggc gctgaatgac aacctccgga gaaagattag ttcgatcaag       960
     atatctccga taagcggggt atatataaga ggcatagcaa cgaacttacc tgagtacaag      1020
     gcagttgggg gatccgataa caaggaccac tatatgggta tgcagctgct ttgcccaact      1080
     ttaagtggtc tagagaaggg ctttcaggaa gcaactatag gcaacaagcc aagcaaaccg      1140
     gcagtgtatc tactcactcc ttcagttgta gatccatcgc tagccccgga gaaacacctg      1200
     gtctacatat gggcgcagcc gtatcctctt cagcttgccg gaggtcaatc ctgggatgat      1260
     gcaacccaag atgtagttgc agatatcttc aacgcgacat cagagtatat agaaggattg      1320
     gtggatatca taaccaaaca cagagttata agaacgcccc ctcagttggc gggtgatttg      1380
     caactaccat atagcaatat aatgcacgga gatatgacga tagaccagct gttctttatg      1440
     agaccaatcc cagagctatc aggctacagg acacccatca aggggttata tttgactgga      1500
     gcaggcacac atccaggtgg aggggtacag ggcgctgcag gcaaaaacac agctgaagtt      1560
     atactggcgg atatgaccaa ggccaaaaga tggataaagc ccgcactagt ggttgcgggc      1620
     tcatctatag catttgctgt attgaggagg agcgctcgtg ccagcaacta a               1671
//

If you have problems or comments...

PBIL Back to PBIL home page