(data stored in ACNUC7421 zone)

EMBL: CP001825.PE63

CP001825.PE63        Location/Qualifiers
FT   CDS_pept        complement(65665..66540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0064"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: sus:Acid_0464 ATP synthase F1, gamma subunit;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40987"
FT                   /db_xref="GOA:D1CDI1"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI1"
FT                   /inference="protein motif:TFAM:TIGR01146"
FT                   /protein_id="ACZ40987.1"
FT                   /translation="MPSTREIRRRIRSIRNTAQITRAMEMVAASRMRRAQQAVTASRPF
FT                   SEKIRHVLADLGASTGGGDSVMHPLLERRPENRVTLILMTSDRGLAGSFNTNIIRTAIN
FT                   FMLDRQDQQVSVIAVGRKGRDYMVRRRRDLKAEFSNIGDLPGLDAITPVAHMIIDEFTS
FT                   GQTDAVYLAYTEYITTLNQRPTLLKILPIEPPEVEEGRETKVPDYIFEPNPAMLLRALL
FT                   PRYVEVQLYQALLESKASEHSARMVAMRNATDNANELVEELTLTYNKLRQANITKEIIE
FT                   IASGAAALEG"
     gtgcctagca ctagggaaat aagacgtagg atacgtagta tcagaaatac agctcagata        60
     actcgtgcga tggaaatggt tgccgcctcc agaatgagga gggctcagca ggctgtgacg       120
     gcatcgaggc ctttctcaga aaagataagg cacgtgctcg ctgacctggg tgcctccact       180
     gggggtggtg attcagtaat gcatccactc ctggaaaggc gtcctgagaa ccgggttacg       240
     ctgatactaa tgacctccga tagagggctt gccggtagct ttaacacgaa cataataaga       300
     acggctatca acttcatgtt agataggcag gatcagcagg tctccgtaat agccgttggt       360
     cgcaagggac gcgattacat ggtacgtcgt aggagggatc ttaaggctga atttagtaat       420
     ataggagatc tgcctggact ggatgctata actcctgtgg ctcacatgat catagatgaa       480
     tttacgtcgg gtcagacaga tgctgtctac cttgcgtata ccgaatatat aactaccctt       540
     aatcagcgac caacactcct aaagatattg ccaatagaac ctccagaagt agaagaggga       600
     agagagacaa aagttccgga ttacatcttc gagcccaacc ctgcaatgct tttgagggct       660
     ctgcttccca ggtacgtaga ggtacagtta taccaggccc tactcgagag taaggctagt       720
     gaacattccg ctcgcatggt tgctatgagg aatgctaccg ataatgcgaa tgagctggta       780
     gaggagctaa cactaactta taacaagcta aggcaagcta acatcacgaa ggagatcatc       840
     gaaatagcaa gcggcgcagc cgctcttgaa ggttaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page