(data stored in ACNUC7421 zone)

EMBL: CP001825.PE64

CP001825.PE64        Location/Qualifiers
FT   CDS_pept        complement(66605..68131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0065"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: gsu:GSU0111 F0F1 ATP synthase subunit alpha;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40988"
FT                   /db_xref="GOA:D1CDI2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI2"
FT                   /inference="protein motif:TFAM:TIGR00962"
FT                   /protein_id="ACZ40988.1"
FT                   /translation="MAIKTEEIAEIIKKQIESFGQPVVTAEVGTVVEVGDGIARAYGLS
FT                   GVKASELVQFENGVYGLALNLEEDNVGIVILGPYTDIEEGQQVRSTGRVVDVPVGDELI
FT                   GRVVNPLGEPIDGKGPINATKRRVIERIAPGVVARKSVDTPVQTGIKAIDSMIPIGRGQ
FT                   RELIIGDRQTGKSAIAIDTIINQKGKDLICIYVAIGQKTSKVAQVVATLEEYGAMEHTI
FT                   VVAANADDPASLQYIAPYAGCAMGEEFMEQGRDALVVYDDLSKHAAAYREISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARLNDEYGGGSLTALPIIETQANDVSAYIPTNVISITDG
FT                   QIYLESDLFYAGIRPAINVGLSVSRVGGAAQTKAMRQVAGKLRLDLAQFRSLAAFAQFG
FT                   SDLDKATRAQLERGQRLTEVLKQPQYSPVPLERQVMIIFAATNGYLDDIPVDSVRDFEN
FT                   RFYEYMDSVHPEIGQEIADKKALSDELTEKLRAAIEEFKQGYTPQQSAPA"
     atggcaatta aaacagaaga aatagctgaa ataatcaaaa agcaaataga gtccttcggt        60
     cagcctgtag tcaccgctga ggtaggtacg gtagtagagg ttggcgatgg tatagccaga       120
     gcatacggac tcagcggtgt aaaggcctcc gagttggttc aattcgaaaa tggtgtgtat       180
     gggcttgctc tcaacctcga agaggataac gtcggtatag ttatcctggg cccctacaca       240
     gatattgagg aggggcagca ggtaaggtcc accgggcgcg tggttgatgt gccggtaggc       300
     gatgagctta taggaagagt tgtcaaccct ctaggagagc ctatagacgg taaaggacct       360
     atcaacgcta ccaagcgtag ggtgattgaa agaatagccc ctggtgtagt tgctagaaaa       420
     tcggttgata caccggtaca gacaggtatc aaggctatag actctatgat tcccataggt       480
     cggggacaaa gagagctgat tatcggcgat aggcagacag gtaagagcgc gattgctatc       540
     gataccataa tcaatcagaa gggcaaggat cttatctgta tctacgtagc aatcggccag       600
     aagacctcca aggttgctca agtagttgcg actctcgaag agtatggcgc tatggagcat       660
     accatagttg tggcagccaa cgctgatgat cctgcttccc tgcagtacat agctccatat       720
     gctggttgtg ctatgggtga agagttcatg gagcagggaa gagatgcgct agtggtttac       780
     gacgaccttt ccaagcatgc tgctgcctat cgcgagataa gcctgctcct gaggagacct       840
     cctggaagag aggcttaccc tggtgatgtg ttctacttgc actctcgcct gcttgagcgt       900
     gctgctcgct tgaatgatga gtacggcggt ggtagcctga cagctctgcc tattattgaa       960
     acccaagcaa atgacgtatc cgcttacatc cctacaaacg tgatctcgat cactgatggt      1020
     cagatatacc tcgagagcga cctgttctat gctggtatca gaccagctat taacgtgggt      1080
     ctctcagtct ctagagtagg cggagctgct cagactaagg caatgcgcca ggtggctggt      1140
     aagctgaggt tggacctggc gcagttcaga agcttggcgg catttgctca attcggttca      1200
     gatctagata aggcaacaag ggctcagcta gaaagagggc agagacttac cgaagttctg      1260
     aagcagcccc agtactcgcc tgtgcccttg gagcgacagg tgatgatcat attcgcggcc      1320
     acgaacggat atctggatga tatacctgtt gacagcgtcc gcgatttcga aaacagattc      1380
     tatgagtaca tggactccgt ccatccggag ataggtcagg agatagccga taagaaggct      1440
     cttagcgatg agcttactga gaagctacga gctgctatcg aggagttcaa gcaaggatat      1500
     actccacagc agtccgcgcc agcatag                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page