(data stored in ACNUC7421 zone)

EMBL: CP001825.PE66

CP001825.PE66        Location/Qualifiers
FT   CDS_pept        complement(68690..69217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0067"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   afw:Anae109_4485 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40990"
FT                   /db_xref="GOA:D1CDI4"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI4"
FT                   /inference="protein motif:TFAM:TIGR01144"
FT                   /protein_id="ACZ40990.1"
FT                   /translation="MSAVLENLGLQLWPFIWQLVAFLILVYVLKRFAFGPVTRILDERA
FT                   ARVRESIETAERIQREAAEQEQRTKQMLEDARRQAQAILQQAQQAAERIQSTAQDNARE
FT                   QANQIIQRAQEDIDRMKAEAIDELRRQVADLAIAAASRIIRKELDPATHRALINEVLAE
FT                   SVDQFRGGRPVA"
     atgtcagcag tactagagaa cctaggttta cagctgtggc cgtttatatg gcaacttgta        60
     gcctttctta ttctggttta cgttcttaag cggtttgctt ttggtcctgt cactcgtatc       120
     ttagatgagc gcgctgcgag agttcgtgag agcatagaaa ctgctgagcg cattcaaaga       180
     gaggccgctg agcaagaaca gcgtacgaag caaatgctcg aggatgctcg tcgtcaggca       240
     caagctatcc tgcaacaagc tcagcaggca gctgagcgta ttcaaagcac agctcaggac       300
     aacgcgcgtg agcaggctaa ccagattatc cagagagcac aggaagatat agatcgcatg       360
     aaggctgagg ctatagatga gcttcggcgc caagtggcag atctagctat tgctgctgct       420
     tccaggataa tacgcaaaga gttggatcct gccactcaca gagcgcttat caacgaggta       480
     ctagctgaga gcgttgatca attcagagga ggcagaccag ttgcctag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page