(data stored in ACNUC7421 zone)

EMBL: CP001825.PE67

CP001825.PE67        Location/Qualifiers
FT   CDS_pept        complement(69324..69635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0068"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   sat:SYN_02965 ATP synthase C chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40991"
FT                   /db_xref="GOA:D1CDI5"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI5"
FT                   /inference="protein motif:TFAM:TIGR01260"
FT                   /protein_id="ACZ40991.1"
FT                   /translation="MDLGVLTDLSNTIVAAAQNAPALQEQAANLTQFKGFASAIAIGVG
FT                   ALGPGLGIGLAVRGAMEATGRNPEASGDIRTTLIIGAALAEAVAIYAFLTALLILFTT"
     ttggatttgg gtgtattgac ggatctaagt aacactatag ttgctgcagc tcagaatgct        60
     ccagcactcc aggaacaggc tgccaatcta actcaattca agggtttcgc ttcggcgatt       120
     gccattggag tgggtgctct aggcccggga cttggtattg gtcttgcagt ccgtggcgct       180
     atggaagcca ctggcaggaa tcccgaggca agtggtgata ttcgaactac tctgatcatc       240
     ggtgctgctc tggcagaggc tgttgctatt tacgccttcc tgacagcact actgatcctg       300
     ttcacaacct ag                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page