(data stored in ACNUC7421 zone)

EMBL: CP001825.PE68

CP001825.PE68        Location/Qualifiers
FT   CDS_pept        complement(69681..70535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0069"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   rce:RC1_0365 ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40992"
FT                   /db_xref="GOA:D1CDI6"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI6"
FT                   /inference="protein motif:TFAM:TIGR01131"
FT                   /protein_id="ACZ40992.1"
FT                   /translation="MPLMLAEQRVGGLARILAQEEEHGKGLLGTPFHQPTLAPETLFHI
FT                   GPIPVTNSMLMTLIVVVALSIAAIWLSRGLSLVPSKRQNFLEAIVELLDNLVQTTAGRT
FT                   AGRAILPLIGTLFIYILVANWASLLPGVGTITWHTEHGDVPLLRAPNADLNMTLAMAIV
FT                   TIVVVQIAGVAAHGVGGHFKEYLNPMHLIDELARVISLSVRLFANVFGGEVLLTVMLAL
FT                   SFLGAIAIIPVVIPMAFMGLEMFIGLIQALVFSLLSLIYITLAVAGHGHPADAEDAESA
FT                   THH"
     gtgcctttga tgcttgctga acaaagagtc ggtggcctag ccaggatact agctcaagaa        60
     gaagagcatg gcaaaggtct tctaggtact cctttccatc agccaacctt ggctccagag       120
     actctcttcc atattggccc aatcccagtg accaactcta tgttaatgac cttaatagta       180
     gttgttgctt tgtccatagc tgctatatgg ctgagtagag gtctttcatt ggtccctagt       240
     aagcgccaga actttctgga ggcaatagtt gagttgttgg ataacttggt gcaaactact       300
     gctggtagaa ctgcgggcag ggcaatactc cctcttatag gtacgctctt tatatacata       360
     cttgtggcta actgggcatc tttgctgcct ggtgttggta ctattacctg gcataccgag       420
     catggggatg tcccattact tagagctccc aatgccgacc tgaacatgac cttggctatg       480
     gctatagtaa ctatagtagt cgtacagata gcaggcgtgg ctgcacatgg cgttggaggg       540
     catttcaagg aatatctcaa tccaatgcat ctgatagatg aactagctcg cgttatctct       600
     ctatccgtac gactttttgc caatgttttt ggtggggaag tgcttctcac ggtaatgttg       660
     gccctgtcgt tccttggggc tatagctata ataccggttg ttatccctat ggcgttcatg       720
     gggctggaaa tgtttatagg tctaatacaa gccctggtgt tttcgttgct gtcgctcata       780
     tacattacgc tagcagttgc tggtcacggc catcctgcgg atgctgagga tgccgaatca       840
     gcgactcatc attag                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page