(data stored in ACNUC7421 zone)

EMBL: CP001825.PE69

CP001825.PE69        Location/Qualifiers
FT   CDS_pept        complement(70892..72571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0071"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="KEGG: bsu:BSU37150 CTP synthetase; TIGRFAM: CTP
FT                   synthase; PFAM: CTP synthase-like; glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40993"
FT                   /db_xref="GOA:D1CDI7"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI7"
FT                   /inference="protein motif:TFAM:TIGR00337"
FT                   /protein_id="ACZ40993.1"
FT                   /translation="MPKFIFVTGGVVSSVGKGIAVAAIGRILKSRGLSVSAQKLDPYIN
FT                   VDAGTMSPFQHGEVFVTDDGAETDLDLGHYERFIDVNLSRNSNVTTGQIYLEVLTAERR
FT                   GDYLGGTVQVIPHITNTIKNRIWSVAETSGADVVIVEVGGTVGDIEGLPFLEAIRQMRR
FT                   EAGRENVFYVHLTFLPYIAATGELKTKPTQHSVNELRRIGINPDVLICRSDHPVTPEIR
FT                   QKIALFGDVDVEAVIPLETAETIYEVPILLEESGLGTYVVDRLNLNAKEPDLTGWKDMV
FT                   AKLKAPKDHSVNIALVGKYTELRDAYISVAEALRHAGLAHNLQINIDWIDSESLENEDV
FT                   DQRLSHVSGIVVPGGFGPRGVEGKIAAAKYARENNIPYLGLCYGMHMLTIEFARNVCGL
FT                   TGANTTEVDPDTQYPVIDLMASQKSLSDKGGTMRLGAYPCSLVAGTKVSKAYGKSLIHE
FT                   RHRHRWEFNNSYREIMENHGLVLSGLSPDGNLVEIVELKDHPWYVGTQFHPEFLSRPMR
FT                   PHPLFLGFIEAASKVVLEGQQHELPLEEDALQSLEDEIQVGV"
     gtgcccaagt tcatctttgt aacaggtgga gtcgttagtt cggtcggtaa aggtatagct        60
     gttgcagcta ttggcaggat actcaaaagt agaggattgt cggtctccgc tcaaaagttg       120
     gatccttata taaatgtcga tgctggtacg atgtcgcctt tccaacatgg agaggtattc       180
     gtcactgatg atggggccga aactgacctc gatttgggtc actatgaaag attcatagat       240
     gtcaatttgt cgcgcaatag caatgtcact actggacaaa tatatctcga ggtactgacc       300
     gccgagcgaa gaggggatta tctaggaggg acagtacaag ttatacctca tataacaaac       360
     acgattaaga acaggatatg gtctgtagct gaaaccagcg gtgcggatgt agtaatagta       420
     gaggtcggag gcactgttgg agatatagaa ggcttgccgt ttctggaagc tataagacag       480
     atgaggaggg aagcaggtag ggagaatgtg ttctacgtgc acctaacctt ccttccctat       540
     atagcggcta ctggagagct caagaccaag cctacccagc acagcgtgaa tgaactcagg       600
     cgcattggaa ttaacccaga cgtactcatc tgtagatctg atcatccagt cacacctgag       660
     ataaggcaga aaatagcttt gtttggggat gtggatgttg aggcagtcat acccctagag       720
     acagctgaga cgatatacga ggttcctata ttacttgagg aatcggggct tggtacttat       780
     gtagtcgacc gtttgaacct caacgcaaag gagccggatc taaccggctg gaaagacatg       840
     gtagccaagc tcaaggctcc caaggatcat tcagtcaaca tagcgttggt aggtaaatac       900
     acagagttgc gggatgccta cataagtgtt gctgaagcat tgcgccatgc tggtttagct       960
     cacaacctcc agatcaacat agactggata gattctgagt ccctggaaaa tgaggatgtc      1020
     gatcagaggt taagccatgt gtcaggcatc gttgtgccag gaggctttgg cccaaggggt      1080
     gtggagggta agatagcagc agccaaatac gcgcgtgaaa ataatatccc ctacctaggt      1140
     ttatgttatg gcatgcatat gctcaccatc gaattcgcca gaaacgtatg tggattgacc      1200
     ggggctaaca cgacggaagt agatcccgac actcagtatc cggtgataga cctgatggca      1260
     agtcagaagt ctctttctga caagggcgga actatgcgac ttggagctta cccatgctct      1320
     cttgttgcag gtactaaggt ttccaaagcc tatggcaagt cgctaataca tgagagacat      1380
     aggcatagat gggagttcaa taatagctat cgtgagatta tggaaaatca tggtttagta      1440
     ctaagtggct tgtcccctga tggtaatcta gtcgaaatag tcgagcttaa ggatcatcct      1500
     tggtatgtag ggactcagtt ccatcccgaa ttccttagca ggccaatgag gcctcaccct      1560
     ctattcctcg ggttcataga ggcggctagc aaagtcgtac ttgaaggcca gcagcatgaa      1620
     ttgccacttg aggaggatgc tcttcagagc ctggaggatg aaatacaagt gggagtatga      1680
//

If you have problems or comments...

PBIL Back to PBIL home page