(data stored in ACNUC7421 zone)

EMBL: CP001825.PE70

CP001825.PE70        Location/Qualifiers
FT   CDS_pept        complement(72591..73238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0072"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /note="KEGG: sus:Acid_7033 Zn-dependent hydrolase of the
FT                   beta-lactamase fold-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40994"
FT                   /db_xref="GOA:D1CDI8"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI8"
FT                   /inference="similar to AA sequence:KEGG:Acid_7033"
FT                   /protein_id="ACZ40994.1"
FT                   /translation="MEITWLGHSCFRIKTKEATVIMDPYSKMEGLDLGRPKADIVTVSH
FT                   DHPGHNNVSSVKGGDDLKVITGPGEYEIKGLFITGVRTYHDKQLGKKLGKNTVYLIETE
FT                   GLVLAHLGDLGHVLDEEQADLMSEVDILLIPVGGGNSLGAEEAVEVISQIEPSIVIPMH
FT                   YKTAPGQANLEGIERFCKEMGLTNWQVEDKLVVRKSDFGEQTEVKILAVKAN"
     ttggagataa cttggcttgg acattcttgc tttaggatca agacgaaaga agctaccgtg        60
     atcatggacc catactctaa gatggagggt ctggatctag gcaggcccaa ggctgatata       120
     gtcactgtaa gccatgacca tccgggacac aacaatgtaa gttctgtaaa aggtggagat       180
     gatctcaaag taataacagg tccaggtgag tacgagatca aagggctctt tatcactggc       240
     gtcaggacat atcatgataa gcagcttggc aagaagctag gtaagaacac agtttatctt       300
     atcgagaccg aggggttggt tctggcgcat cttggcgacc tggggcatgt gctagatgag       360
     gaacaggctg accttatgtc cgaagtggac atactgctta ttcctgtagg cggaggtaac       420
     tctctgggtg ctgaagaagc agtcgaggtt atctcccaaa tagagccttc tattgtgatt       480
     cctatgcact acaaaacagc acccggccag gctaatcttg aaggaataga gaggttttgt       540
     aaagaaatgg gattaactaa ctggcaggtt gaagacaagc tcgttgttcg caagtctgat       600
     tttggcgagc aaacagaagt caagattctt gcagtaaagg cgaactag                    648
//

If you have problems or comments...

PBIL Back to PBIL home page