(data stored in ACNUC7421 zone)

EMBL: CP001825.PE74

CP001825.PE74        Location/Qualifiers
FT   CDS_pept        75746..77821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40998"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ40998.1"
FT                   /translation="MPRSLLSLLLNLEVEKLRDIALWWCVDLPNGTRSEQATILAREIL
FT                   RSDTSLYMYWERIGPEPRDLLLRIAEHSELRLSQLPASKDDPALRDLIASGMVWKLSEA
FT                   DLRSERVYTHTTSSDPYLLIPRELIRMITRLKRKLQEGDTSDKPLEFYLEGMGTGELEA
FT                   VALNWGLADEPGSYTREEIIKSLLEELEKTPTSRVLKKLTTNALMVYRSLLEEGKAYGF
FT                   ELAKSLNLPLPAMREAVIELTENILVQEAIYNDRWLIFPTRGLIHTTKSKSYVSPPEVY
FT                   TPRKQVKNPDYAPAWDLLHLLRAYQLYDLPYPNNTEIEEALFNRLSSLIFTNSEDKASH
FT                   AKLLFHLSRDLGLVSENAGMITTTKAVESWIKLPIEVQAKRIFKAWIETKYDESHGLLK
FT                   QAPGYSDSQELLKKARLEIIEILSACHVDKWYSIEQVSEIIRQEHPYIIRTNNRLVREL
FT                   GLEGAQKALEEWPRYEGRWITLLFQGPLTWLHVVETSSDELNPAFSLTPDGAFLIGKSK
FT                   TKYESKLAKSLSIQGHNSGLQIRVPRPESSLIWTLSAFARPHKWHESGLGIYVADRRTV
FT                   ARARGVNLSPSGIVEFLEEHSKEKLPNSITSKLEEWGKEPYKVSFAQGLVLTLDSTEAV
FT                   RDLQKLSFIQHFHPMIIDETKVLLFLPKDNYEREVSNLLRRLNKTGLFVVENNYGG"
     atgcctcgaa gcttattgtc gctcttactc aatttagaag tagaaaagct aagggatatc        60
     gcactttggt ggtgtgtgga tctcccaaac gggactagat cggagcaggc aactatactc       120
     gcaagggaga tcctgaggtc cgatacatct ttgtatatgt attgggaaag aataggtccc       180
     gagcctagag acctactact aagaatagct gaacattctg aattgaggct ctcacagttg       240
     ccagccagta aggacgatcc agcactcagg gacctaatag cgtcaggaat ggtatggaag       300
     ctgagcgaag ccgatctgag gtccgaaaga gtctatacac ataccacttc ctccgatcct       360
     tatctgctaa tcccaagaga gctaatacgc atgatcacga ggctaaagag aaaacttcag       420
     gaaggcgaca cgtcggacaa gccattagag ttttacttag agggcatggg gactggtgag       480
     ctcgaggctg tagctctaaa ttggggtctg gcagatgaac ccggaagcta caccagagaa       540
     gagataatca aatctctgct agaagagctg gaaaagactc ccacatcaag agtattgaaa       600
     aagcttacta ccaacgctct aatggtctat cgatctctat tagaagaagg taaagcttac       660
     ggattcgaac ttgccaagag tctgaacttg cctcttccag caatgcgaga ggctgtaata       720
     gagctgaccg agaacattct tgtgcaggaa gctatataca acgacagatg gttgatcttc       780
     ccaaccagag gattgataca tacaaccaag tctaagagct acgtttcccc tcctgaagtt       840
     tatacgcctc gtaagcaagt aaaaaaccct gactatgccc cagcatggga cttgctacac       900
     ctactacgtg cataccagct atatgatcta ccttatccca ataacactga aatagaagag       960
     gcgctgttta atagactgag cagtctcata tttaccaact ccgaggacaa agcctcgcac      1020
     gccaagctgc tattccatct aagccgcgac ctgggactag tatctgaaaa tgcaggcatg      1080
     attaccacaa caaaggcggt tgagagttgg ataaagctac caatcgaagt ccaagctaag      1140
     aggatattta aagcatggat agagacgaaa tacgatgaat ctcatggcct tcttaagcaa      1200
     gctcctggct acagcgacag ccaggaatta ttgaaaaagg cgcgtttgga gataatagag      1260
     atactatccg catgtcatgt ggataagtgg tacagtatag agcaggtatc cgagataatt      1320
     aggcaagaac atccttatat cataaggacc aacaatcgac tagttagaga actaggatta      1380
     gagggggcac agaaggcctt agaagaatgg ccaaggtatg aaggtcgttg gataacactc      1440
     ttattccaag ggcctcttac gtggctacac gtagtagaga catcctctga tgaactcaat      1500
     ccagcattct cccttacacc ggatggtgca tttcttatag gtaaatcaaa gactaaatac      1560
     gagtccaagc ttgcgaaatc cttgtccatc caaggccata actccggtct acaaattaga      1620
     gtacccaggc cagaatcatc actcatttgg actctatctg cctttgccag accccataag      1680
     tggcacgagt cgggtttggg aatatacgtg gcagatcgta gaactgtagc cagggctagg      1740
     ggagtaaacc ttagtccatc tggaatagtt gagtttctgg aagagcactc caaagaaaag      1800
     ctccctaatt ctattaccag taagttggaa gagtggggga aagagcctta taaggtcagt      1860
     tttgcacaag ggttggttct taccctggac agcacagagg ctgttagaga tcttcaaaag      1920
     ctatctttta ttcagcactt tcaccccatg atcatagacg agaccaaggt gctgttattc      1980
     cttcccaaag ataactatga gcgtgaggtc tcgaatctgt tacgtaggct gaataagaca      2040
     gggctgttcg ttgtagaaaa taattatggg ggataa                                2076
//

If you have problems or comments...

PBIL Back to PBIL home page