(data stored in ACNUC7421 zone)

EMBL: CP001825.PE76

CP001825.PE76        Location/Qualifiers
FT   CDS_pept        79436..80785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0078"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; FAD dependent oxidoreductase; KEGG:
FT                   gsu:GSU0493 pyridine nucleotide-disulphide oxidoreductase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41000"
FT                   /db_xref="GOA:D1CDJ4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDJ4"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACZ41000.1"
FT                   /translation="MTVGARIDLLSKGHRSQTEEEYRKASYKILILGAGFGGIQAAIEL
FT                   DKHLGKRQDVSILVVDRDNTQLFQPLLWTVASGKNCPDDTTVPIRKFQKGRSFHVMHSA
FT                   VKHIDLQNQVVYFDNGEDRPFDFLVIALGSVTAIPDLPGLRERALLFRSPADAIELRNK
FT                   VIDALEMAHKEQDPEARKSWLTFVVGGGGDTGIELAATLKEYIYAGLFAEYPWLENEPA
FT                   RIVLVSRSSRLVPQSRPHISKTVQEVLEHEGIEVMNNTSVEAVTEDEVKTSAGTIKART
FT                   LFWAAGITAPKVVKDLPVEHARNGSLIVDKFLRIPQYPNVFVVGDSAWAFDARTNDPIP
FT                   PTAQAAEHMGRYVGRTISSLIQNRSIKPFVFKPLGHLALLGQRTGVAEVGPLTFTGIPA
FT                   WFIWHSYYLIHIPSWQNRIYLFTHWLLSLILGRETGQLRLSPGVLKEGIQ"
     atgactgttg gtgcccgtat tgatctgcta agcaagggac atagaagcca aactgaggaa        60
     gaatacagaa aagctagtta taagatactc atactaggag ccggctttgg gggcatacag       120
     gcggccatag agctcgacaa acacctaggt aagaggcagg atgttagtat cctagtagtg       180
     gatcgggaca atacccagct gttccagccc ttactgtgga ccgtagcctc cggcaagaac       240
     tgcccagatg atactactgt ccctatcagg aagtttcaaa agggaagaag ctttcacgtc       300
     atgcattccg cagtcaaaca tatcgatcta cagaaccagg tggtctactt tgacaacgga       360
     gaggataggc cattcgattt cttagtgatc gctttgggca gcgtaactgc tatcccggac       420
     ctaccagggc taagagaaag agcactactc tttaggagcc ctgcagacgc tatagagcta       480
     agaaacaaag taatagatgc ccttgaaatg gctcataaag aacaagatcc cgaagcacgt       540
     aagtcttggc ttacgttcgt ggtcggcgga ggtggtgata ccggcatcga attggctgcc       600
     acactcaagg aatacatata cgcgggactc tttgccgaat atccctggct agagaatgag       660
     ccagctagaa tcgtgcttgt aagcaggtcc agtagactag tcccacaaag cagaccacat       720
     atatctaaga ccgtgcagga ggtacttgaa cacgaaggca tagaggtaat gaataacaca       780
     tctgtggaag cagtaactga agatgaggta aagacttctg caggaactat aaaggctcgt       840
     accctttttt gggctgccgg tataacagcg ccaaaggttg taaaggatct gcctgtggag       900
     cacgccagaa atggatcttt gatcgtagat aagtttttgc gtattcccca atacccaaac       960
     gtctttgttg taggagactc tgcatgggca ttcgatgcaa gaactaacga ccctatacct      1020
     cccacagcac aagcagctga gcacatgggc cggtacgtcg gcagaacaat atcaagtctt      1080
     atacagaata gaagcataaa acccttcgtt ttcaagcctc taggtcatct agccttactg      1140
     ggacaacgca ccggtgtcgc agaagttgga ccacttacct ttaccggtat accagcttgg      1200
     tttatctggc actcatacta cttaatacac ataccttcat ggcaaaacag aatttatcta      1260
     ttcactcact ggctactatc attgattctc ggcagagaga ccggtcagct gaggctgtca      1320
     cctggcgtac tcaaggaggg tatacagtaa                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page