(data stored in ACNUC7421 zone)

EMBL: CP001825.PE79

CP001825.PE79        Location/Qualifiers
FT   CDS_pept        83548..85662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0081"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: AVP2; AVP2 (ARABIDOPSIS VACUOLAR H+-
FT                   PYROPHOSPHATASE 2); TIGRFAM: V-type H(+)-translocating
FT                   pyrophosphatase; PFAM: Inorganic H pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41003"
FT                   /db_xref="GOA:D1CDJ7"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDJ7"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ACZ41003.1"
FT                   /translation="MSNEVLWAILIFGAGILAVIFALSMARYVLSRDTGTPEMKAVADT
FT                   IYEGAIAYLNRQYTTIASIAVITAIIIGAIIALVGSETMDLPGPQAAIMTAIAFLAGAL
FT                   ASGVSGYIAMLVAVKSNVRTAAAARRSLGDALLVSLRGGAAGAFFIIALSIMGVAAIFY
FT                   AYNGFNQPERAPFLIVGFGFGASFVALFAQLGGGIYTKAADVGADLVGKVEAGIPEDDP
FT                   RNPAVIADLVGDNVGDCAGRGADLFESTAAENIGAMILGVSIFLATGRDNPGFIFLSLV
FT                   LGAMGLIASMIGVLSVRPSANADPMGALNRGFAVTAVLSIIGLFIATLWVLDGNWWLFG
FT                   CGLVGIITSILFLLMTQYYTSEKYRPVRTIAEASKTGPATNIISGIAIGFENTALPAIV
FT                   ISLAIGTAYFFGTRTGFSDNSFVNGVYGTAVATMGMLMTVAYVLAMDIFGPITDNAGGV
FT                   VEMSNQPEEVRERTDALDAVGNTTKALTKGYAIGSAALAAFLLFSAYLSDARLEAVNLA
FT                   RVPVFIGGFLGGMLVFLFSSLAIRAVGRAAGDMIEEVRRQFRSEPGIMQGTVRPNYAKA
FT                   VDISTRAALREMVLPGILAVGMPVVVGLILRAEAVAALLMVGTMTGILVALVLNNGGGA
FT                   WDNAKKLIESGQLLDEEGKPIGKGTATHAAAVVGDTVGDPFKDTAGPSLHVLIKLLSTV
FT                   TLVLAPLFIR"
     atgagcaacg aggtattatg ggcaatactt atatttggtg ctggaatact ggcagttatc        60
     ttcgccctct caatggccag gtatgtcctc agtcgagaca ctgggactcc agagatgaag       120
     gccgtggccg acacaatata tgagggggca atcgcttatc tgaaccgtca atacactacg       180
     atagcaagca tagcggttat cacagcaatt attatcggag ccattatcgc cctagtaggc       240
     agcgagacta tggatcttcc gggacctcag gcggcgataa tgactgcgat agctttcctg       300
     gctggggccc tagcctcagg agtatctgga tacattgcta tgcttgtagc agtcaaatct       360
     aacgtgagga ctgccgccgc agctagaaga agcctaggag atgcactact cgtttcccta       420
     agaggtggtg ctgctggagc attcttcata atcgcgctct ccataatggg cgttgcggcc       480
     atattctacg cttacaacgg cttcaatcag cctgagagag ctccttttct catagtaggc       540
     tttggcttcg gagcatcctt tgttgctctt ttcgcacaac ttggaggagg tatttatacc       600
     aaggctgcag atgtaggagc tgacctggta ggtaaggtgg aagcaggaat acctgaagac       660
     gatcccagaa accccgctgt tatagcagac cttgtaggtg ataacgtagg tgactgcgct       720
     ggacgcggag cggacctgtt cgaatccact gcggctgaaa acatcggagc tatgatcctt       780
     ggggtatcca tatttctggc aacgggaagg gataacccag gctttatatt cctctcgctt       840
     gtacttggtg ctatggggct tatagcctcc atgataggag tactctctgt cagaccaagc       900
     gctaacgcag acccaatggg tgccctgaac agaggttttg cagtaacagc agtcctgtct       960
     ataatcggac tcttcatcgc cactctttgg gtactagacg gtaattggtg gctatttggt      1020
     tgtgggctgg taggtatcat aacatcgata cttttcctgc tcatgaccca gtactatacc      1080
     tccgagaagt acagaccagt caggaccata gctgaggcat ccaagacagg cccagcaact      1140
     aacatcatct ctggtatagc tatcggtttt gaaaacaccg ctctgccagc gatagtcatc      1200
     tctttggcta taggtacagc ctacttcttc ggcaccagaa cgggctttag cgacaactcc      1260
     ttcgtgaacg gagtgtatgg aactgctgta gcaactatgg gaatgcttat gacagtggcc      1320
     tatgtgctgg ccatggacat cttcggtcct attacagata atgctggcgg cgtcgtagag      1380
     atgagcaacc agccagagga agtgagagaa cgtacagatg cactcgatgc agtaggtaac      1440
     acaaccaagg ctcttaccaa gggttatgct ataggttccg ctgctttggc tgctttcctc      1500
     ctgttctcag cctatctctc cgacgcaaga ctagaagctg tcaatctagc ccgcgtaccg      1560
     gtattcatag gcggcttcct tggtggtatg ttagtgttcc tgtttagctc gctggctatc      1620
     agggcagtgg gacgtgcagc aggagatatg attgaagagg tacgtcgcca attcagaagc      1680
     gaaccaggca tcatgcaagg cacagtacgt cccaactatg caaaggctgt ggatataagc      1740
     actagagctg ctcttagaga gatggtccta cctggtatcc tggcagtagg aatgcccgta      1800
     gtggttggac tgatactaag agctgaagct gtagcagccc ttctgatggt cggtactatg      1860
     acaggcatat tggtagccct agtactcaac aacggtggtg gcgcatggga caatgccaag      1920
     aaactgatag aatccggcca gctgctagat gaagaaggca agcctatagg aaagggaaca      1980
     gctacccacg cagcggcagt ggtgggtgat acggtaggtg atcctttcaa ggatacagct      2040
     ggaccgtctc tgcatgtgct gatcaaactg ctatctaccg taactctggt acttgctcct      2100
     ctgttcatca gataa                                                       2115
//

If you have problems or comments...

PBIL Back to PBIL home page