(data stored in ACNUC7421 zone)

EMBL: CP001825.PE83

CP001825.PE83        Location/Qualifiers
FT   CDS_pept        complement(94586..95077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0085"
FT                   /product="dUTPase"
FT                   /note="KEGG: dUTPase; K01567"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41007"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK1"
FT                   /inference="similar to AA sequence:KEGG:AFUA_3G14580"
FT                   /protein_id="ACZ41007.1"
FT                   /translation="MSEEVDTNAADFIRDYIDLEEQTQPNGVELTLAWVERFLEAGKLA
FT                   FDNSERVLPRTERLEFDSEGWIWLPQSSYKIGFNEFVTIPEDRFAIARPRSSLLRMGVS
FT                   VGTALWDSGFRGKGEAILCVHNPHGFWVRKNARVVQLVFFKLPTRAHKLYEGQYKDRTW
FT                   "
     atgtctgagg aagtagatac caacgcagca gattttatta gggattacat agaccttgag        60
     gaacagacgc agcccaacgg tgtagaactt acactcgctt gggtggagcg ttttctggaa       120
     gctggcaagc tggcatttga taacagcgag agagtcttgc cacggactga gaggcttgag       180
     tttgactcag aaggctggat atggctacca cagagctcct acaagattgg tttcaatgag       240
     tttgtgacta ttcctgagga taggtttgct attgcgaggc ctcgatccag ccttctaaga       300
     atgggggtgt cggttggaac ggccctatgg gattcaggtt ttagggggaa aggcgaagct       360
     attctttgtg tgcataatcc gcatggattt tgggtacgta agaatgctcg cgtagtgcag       420
     ttagtattct tcaaactacc tactagggca cacaagctgt acgaaggaca gtacaaagat       480
     cgcacgtggt ag                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page