(data stored in ACNUC7421 zone)

EMBL: CP001825.PE85

CP001825.PE85        Location/Qualifiers
FT   CDS_pept        95778..96719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0087"
FT                   /product="peptidase S58 DmpA"
FT                   /note="PFAM: peptidase S58 DmpA; KEGG: dac:Daci_2906
FT                   peptidase S58 DmpA"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41009"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK3"
FT                   /inference="protein motif:PFAM:PF03576"
FT                   /protein_id="ACZ41009.1"
FT                   /translation="MQDSILDVAGIEVGSSEDQTIRTGCTVVLCKQGATVGVDVRGAAP
FT                   ATRETDLCRSGNLVSKVHAILLTGGSAFGLDSASGVMRFLWERGIGFDTPATRVPIVPA
FT                   AAIYDLNVGRVGWPHSEMAYQACREATSKTMSRGRVGAGTGATVGKILGPKNCTEGGLG
FT                   SASERVGSFRVGALVVVNALGDVVDPNSGKIIAGPKDPLTGNFISTEDVLLEGRPSTSN
FT                   EGQNTTLVVVATDAPLSKEQANRLASISHDGLARVIRPAHTLVDGDVVFALSTTADNQV
FT                   VTTDQMIALGVGAIRAVERAILDAVAVKVNHR"
     atgcaagaca gcatactaga tgtagcgggt atcgaagttg gtagctctga agaccaaacc        60
     attcgtaccg gttgcacagt agtgctgtgc aagcagggag ctactgtagg ggtagatgtt       120
     aggggagctg ctccagctac gagagaaaca gatctatgca gatccggtaa tctagtcagc       180
     aaagtacacg caatcctcct gacaggtggt agcgcttttg gattggattc agcaagtggt       240
     gtaatgcgtt tcctatggga gagaggaatt ggttttgata ctccagcaac cagggttcca       300
     atagttccag cagctgccat ctatgaccta aatgtaggta gagtaggctg gcctcactcc       360
     gagatggcat atcaagcctg tcgggaagct accagcaaga caatgagcag aggtagagtg       420
     ggggctggaa ctggcgccac cgtagggaag atccttggtc ccaagaactg caccgaaggg       480
     ggcttgggct cagcaagtga gcgggtagga agtttccgtg taggtgcgct agtagtggtt       540
     aatgctctgg gagatgtggt tgatcctaat agtggcaaga taatagcagg tccaaaagat       600
     cctttaacag ggaatttcat aagtacagag gacgtccttc tagagggaag accaagcaca       660
     tcaaatgaag ggcaaaacac taccctggtc gtagttgcta cagacgcacc tctatctaag       720
     gaacaagcaa acaggctcgc ctctatatca catgatggcc tagccagagt tattcgtcct       780
     gcgcatacac tggtagatgg agacgtggtt tttgccctct ctacgactgc agataatcag       840
     gtagttacca cagatcaaat gatagctcta ggtgttggag ctataagagc cgtagagcgg       900
     gcaatcctgg acgcggtagc ggtaaaggta aatcatcgtt ag                          942
//

If you have problems or comments...

PBIL Back to PBIL home page