(data stored in ACNUC7421 zone)

EMBL: CP001825.PE87

CP001825.PE87        Location/Qualifiers
FT   CDS_pept        complement(97174..99813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0089"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="KEGG: dal:Dalk_2944 alanyl-tRNA synthetase; TIGRFAM:
FT                   alanyl-tRNA synthetase; PFAM: alanyl-tRNA synthetase class
FT                   IIc; phosphoesterase DHHA1; Threonyl/alanyl tRNA synthetase
FT                   SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41011"
FT                   /db_xref="GOA:D1CDK5"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK5"
FT                   /inference="protein motif:TFAM:TIGR00344"
FT                   /protein_id="ACZ41011.1"
FT                   /translation="MKSSEIRSKFLEFFEARGHTVVPSSSLVPAKDPTLLFTNSGMVQF
FT                   KDVFLGRESRSYTRATTAQKCMRAGGKHNDLENVGPSARHLTFFEMLGNFSFGDYFKRE
FT                   AIGYAWEFVTQVLGLEPSRLWATVHYTDDEAASLWQEVAGLPESRIIRMGDEDNFWQMA
FT                   DVGPCGPNSEIFYDRGPEKGCGDPNCTPAHDCGRFWEFWNLVFMQYYQDESGNRTPLPK
FT                   KNIDTGLGLERTSAIMQGVDSIFETDLFVPIMDEVQRIAGHSDEDRRREIVAYRVIADH
FT                   SRSLAFLIADGVTPGNEGRSYVLRRIIRRAIRFGRRIGIEGHFLSDTARVVVDIMGHHY
FT                   TELEDQWSFIDKVTRAEEEHFSRTLARGVAQLDDLIDKLSASGQKEIPGEDAFRLYDTY
FT                   GFPLDLTLELARDRGFSVDTEGFKRAMERQRAQSRAASTFTAKMPAAYAALSGEPTQFT
FT                   GYTTLEDTGRVMAIIREGELVDKVEHGQEAEILLDRTPFYAEAGGQVGDTGVITGPEGD
FT                   FHVLDTQRPVNGYILHRGRVLHGSISVGQNVDLVVDARRRQDIMRNHTATHILHKTLRD
FT                   VLGPHARQAGSLVAPDRLRFDFTHPSQLSDEEFFEIERIINDVSQDDRKVYAQEKPYTE
FT                   AIASGAMALFGEKYGDIVRVVSIEDYGSELCGGTHVHHTGEIGPIYITSEGSIASGVRR
FT                   VEAVTGRGAIKYARERMELLERLGAKLKVPTSEIERQVALLQERLREQERQIEQLRRQL
FT                   AAGEIDQMLRNVRQVDGTKLLVAQTSLDSREAMSDLADRLRDRLRSGVVVVGSVLQGKP
FT                   SIVAVVTPDLVQKGVHAGKLVKEISALVGGGGGGRPDRAEAGGRFPEKLEEALGSVDEV
FT                   LARQLEGK"
     atgaagagta gcgaaattag atccaagttt cttgaattct ttgaggctcg tggccacact        60
     gtcgtaccta gctcttcgct agttccggcc aaagacccca ccttgctgtt taccaactct       120
     ggaatggtgc aatttaagga tgtcttttta ggcagggagt ctcgatctta taccagagcg       180
     accacagccc aaaaatgtat gcgggcgggt ggcaagcata atgacctgga gaatgttggt       240
     cccagtgcca ggcatctgac tttttttgag atgctgggca actttagttt tggagactac       300
     ttcaagcgtg aggctattgg ttacgcttgg gaatttgtta ctcaggtgct gggtcttgaa       360
     ccttccaggc tgtgggccac ggtgcattac acagatgatg aagccgcgtc cttatggcag       420
     gaggtagccg gtctccctga gagcagaata atacggatgg gagatgagga taatttctgg       480
     cagatggcgg atgttggtcc gtgtggaccg aattctgaga tattctatga tcgtggcccg       540
     gaaaagggat gcggagatcc aaactgtact cctgcgcatg attgtggaag gttttgggag       600
     ttttggaacc tggtctttat gcagtactac caggatgagt cagggaacag gactccactg       660
     cccaagaaga atatagatac aggactgggc ttggaacgca cctcggcaat catgcaaggt       720
     gttgactcta tattcgagac cgacctcttt gtacctatta tggatgaggt ccagcgaata       780
     gctgggcaca gcgatgagga tcgccgaaga gagatagttg cttatagagt tattgccgat       840
     catagtagat ctcttgcgtt tttgatagca gatggagtta ccccgggtaa tgaggggagg       900
     tcctatgtcc tgcgaaggat tatcagaagg gcaatacgtt ttggtaggcg aattggcatc       960
     gaaggacatt tccttagcga cactgccaga gtagtagtcg acataatggg tcatcattat      1020
     actgagctcg aggaccaatg gagtttcatt gataaggtta caagggcaga agaagagcat      1080
     ttctccagga ccttggccag gggagtggct cagcttgatg atttgatcga caagctgtcg      1140
     gcaagtggcc agaaggagat tcccggagag gatgcatttc gtctttatga cacatatggt      1200
     ttcccactgg accttactct ggaacttgcc agggatcgtg gtttctcggt tgataccgag      1260
     ggattcaaac gtgccatgga gaggcagcga gctcagagtc gagctgcaag taccttcact      1320
     gcaaagatgc ccgctgccta tgctgcgctg agcggtgaac ccactcaatt taccggctat      1380
     accaccctag aggataccgg cagggtcatg gccattatcc gagagggtga gcttgtcgat      1440
     aaggtcgaac atggacaaga agctgagata ctcctcgaca ggacaccttt ttatgccgaa      1500
     gctggtggtc aagtgggaga tactggcgtt ataacaggtc cggagggtga tttccatgta      1560
     ttggatactc aaagacctgt caatggctat atcctgcata ggggtagagt actacatggc      1620
     tccatcagtg tggggcagaa tgttgatcta gtggtagatg ccagacggcg ccaggatatc      1680
     atgagaaacc acaccgcgac gcatatcctg cacaagactt tgagggatgt gctaggtcct      1740
     cacgctcgcc aggctggttc gctagtagct ccagataggt tgcgatttga ctttacacac      1800
     ccttcgcagc tatcagatga ggagttcttc gaaatcgaga gaataatcaa tgacgttagc      1860
     caggatgaca gaaaagtcta tgcacaggag aagccttaca ctgaagcgat agcttctgga      1920
     gctatggctc tgttcggaga gaaatacgga gatatagtga gggttgtaag tatagaggat      1980
     tatggtagcg agctttgtgg tggcacgcat gtgcatcata ctggcgagat aggtcctata      2040
     tatatcacca gtgaggggag catagctagt ggagtaagaa gagttgaggc tgttactggt      2100
     agaggagcaa tcaagtacgc tcgagagagg atggagctgc tcgagcgctt aggagctaag      2160
     ctaaaagttc ccacttctga gatagagagg caggttgctc tgctccaaga aagacttaga      2220
     gagcaggaga gacagataga acagcttagg agacagcttg ctgctggtga gatagatcag      2280
     atgctgcgca acgttcgtca ggtcgatggc actaagctgt tggtggctca gacgagcctc      2340
     gatagccggg aagccatgtc cgaccttgct gatagactta gagatcgact aagatccgga      2400
     gtggtagtgg taggctctgt ccttcagggc aagcctagta tagtggctgt agtcaccccg      2460
     gacctagtcc agaagggtgt gcatgctggc aagctcgtca aggagatatc tgctcttgtt      2520
     ggtggaggcg gaggtgggag acccgataga gccgaggctg gaggtcgttt ccctgagaag      2580
     cttgaggaag ctcttggctc tgttgatgag gtgctcgcaa ggcagcttga aggtaagtaa      2640
//

If you have problems or comments...

PBIL Back to PBIL home page