(data stored in ACNUC7421 zone)

EMBL: CP001825.PE89

CP001825.PE89        Location/Qualifiers
FT   CDS_pept        101129..102103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0091"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: mxa:MXAN_2667 pyruvate dehydrogenase
FT                   subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41013"
FT                   /db_xref="GOA:D1CDK7"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK7"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACZ41013.1"
FT                   /translation="MAVKTYREALNEALREEMERDPNVFIIGEDVGKFEGAYRVTQGLL
FT                   AQFGPKRVRDAPISETGFLGAGIGAAMLGLRPVVEFMTINFILVAMDQVINHAAKIRYM
FT                   FGGEVSVPMVIRAPGGAGQQLTAQHSQSFEVWFAHTPGLKVMAPSSPSDAKGMLKTAIR
FT                   DPDPVFFLENLALYNTKGEVPEGEYTVPLGKADVKRQGTDVTLISHSRAVNWCLQAAQQ
FT                   LEKEGVSVEVVDLRSLRPLDMETVIESVKKTNRAVTVEEGWLSFGVGAEVASRLMEQAF
FT                   DYLDAPVLRVGGAEVPMPYAKPLERAAMPSVDKIVARVREVLE"
     ttggctgtca agacctatcg cgaagcactc aacgaagctc ttagagagga gatggaacgc        60
     gatcccaatg tcttcatcat aggagaagac gttgggaagt ttgaaggagc atatagagta       120
     actcaagggc ttttagctca gttcggacct aagagagtca gagacgcccc catatcagaa       180
     acaggcttcc ttggggctgg tataggggcc gcgatgcttg gcctgaggcc ggtagtggag       240
     ttcatgacca taaactttat cctcgtggcc atggatcaag tcatcaacca cgcagccaag       300
     atacgctaca tgttcggtgg cgaagtatcc gtacctatgg ttatacgtgc tccaggtggt       360
     gcaggccagc agctgactgc ccagcactca cagagtttcg aggtatggtt tgctcacaca       420
     ccagggctaa aggtcatggc tccatcgagt ccctctgatg caaaggggat gctcaagacc       480
     gctataagag acccagaccc tgtcttcttc ctggagaact tagctctcta taacactaag       540
     ggcgaagttc ctgagggaga atatactgtg cctctaggca aggctgacgt aaaacgtcaa       600
     ggcacagacg taactcttat ctcccactca agggccgtga actggtgctt gcaagcagcg       660
     caacagcttg agaaagaggg cgtgagcgtg gaggtagtag accttaggtc gttaagacct       720
     ctcgacatgg agacggtaat agagtccgtg aagaagacca atagagcagt cacagtagag       780
     gaaggatggc tgagctttgg cgtgggggcg gaggtagcca gcagactaat ggagcaggct       840
     tttgactact tagacgcccc agtactaaga gttggtggag cagaggtgcc aatgccctat       900
     gccaaacccc tggagagggc cgctatgccc tcagtagaca agatagttgc gagagtcaga       960
     gaagtactcg agtaa                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page