(data stored in ACNUC7421 zone)

EMBL: CP001825.PE90

CP001825.PE90        Location/Qualifiers
FT   CDS_pept        102136..103377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0092"
FT                   /product="Dihydrolipoyllysine-residue succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="PFAM: catalytic domain of components of various
FT                   dehydrogenase complexes; biotin/lipoyl attachment domain-
FT                   containing protein; E3 binding domain protein; KEGG:
FT                   mxa:MXAN_2668 pyruvate dehydrogenase complex , E2
FT                   component, dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41014"
FT                   /db_xref="GOA:D1CDK8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK8"
FT                   /inference="protein motif:PRIAM:2.3.1.61"
FT                   /protein_id="ACZ41014.1"
FT                   /translation="MNLTMPRLSDTMEEGTVGKWLKKEGDSFKKGEAIAEIQTDKANME
FT                   LEAFQDGVIEKILVQEGQTVPVGEPIAIIRSPSEAPGPSETPTTEEPKHETKPQEPVQE
FT                   QTPQPAESPIPIAPREEAGTAGPQGRIKASPLARRIAQELGIDLATVKGTGPNGRIKRE
FT                   DVERAAASRTQAPKVEEIPAAEAAPPSRVEPFTRIQSIIAQRMVQSKTQVPHIYITIEL
FT                   DMSKAIALRQEINQLGEPPVSFNDMVIKACGLALRNYPLANASYVDGGIKYNEQVNVGF
FT                   AVATKGALYVPVIRDADKKNLRQIAAETRALINKARENKLSPQDLSGGTFTVSNLGMYG
FT                   VEEFQAVVNQPEAAILAVGAITQKPVVQDGQIVIGNRMRVTLSADHRVLYGADAAEFLN
FT                   ELRKFLENPLLLAF"
     atgaacctaa cgatgcctag acttagcgat accatggagg aaggcaccgt aggtaagtgg        60
     ctcaagaaag aaggtgactc cttcaaaaaa ggtgaggcaa tagccgagat acagacagat       120
     aaagctaaca tggagcttga ggcctttcag gatggagtca ttgagaagat actcgtccag       180
     gaaggacaaa ccgtaccagt aggagagcca atagcaatca tccgctcacc atcggaggcg       240
     ccaggacctt ctgagacacc cactacagaa gaaccaaagc atgaaactaa accccaagag       300
     cctgtgcagg agcaaactcc tcagccagct gaaagcccga ttccgatcgc tccgcgtgag       360
     gaggcgggga ctgctggccc tcaaggccgt ataaaggctt cgcctcttgc tcgacgtatc       420
     gcacaggaac taggtataga ccttgccacc gtcaaaggta caggccctaa cggcaggatc       480
     aagagagaag atgtagagag agcagctgca tcaaggactc aggcacccaa agttgaagag       540
     atacctgccg cagaggcagc accacccagc agagtagagc cctttactcg cattcagagc       600
     atcatcgctc agaggatggt gcaaagcaag acgcaggtac cacacatcta tatcactatt       660
     gaattggata tgtctaaggc catagctttg cgacaggaga tcaatcagtt aggtgagcca       720
     cctgtaagct tcaacgatat ggttataaag gcctgtggct tggcgctgcg taactatccg       780
     ttagctaatg cctcttatgt tgatggaggt ataaagtata acgaacaagt aaatgtgggc       840
     tttgccgtag ctactaaagg ggctctgtat gtccctgtaa taagagatgc tgacaagaag       900
     aacctcaggc agatagctgc tgaaaccagg gctctgataa acaaagctag agaaaataag       960
     ctcagccccc aggatctgtc tggaggaaca ttcacagtat ctaatctggg aatgtatggt      1020
     gttgaggagt ttcaagccgt agttaaccag cctgaggctg cgattcttgc agttggggca      1080
     atcacccaga agccggtcgt gcaggatgga cagatagtta taggtaatcg tatgagagta      1140
     actctctcag cggatcatcg tgttctgtac ggagccgacg cagcagagtt tctcaatgag      1200
     ttaaggaagt tcctggaaaa tcctctgctg ctggccttct aa                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page