(data stored in ACNUC7421 zone)

EMBL: CP001825.PE92

CP001825.PE92        Location/Qualifiers
FT   CDS_pept        104464..105450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0094"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: bha:BH2762 branched-chain alpha-keto
FT                   acid dehydrogenase E1"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41016"
FT                   /db_xref="GOA:D1CDL0"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDL0"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACZ41016.1"
FT                   /translation="MATKTVIQTIRDTLFEEMERDERIIILGEDVGLAGGVFGATKGLQ
FT                   ERFGEWRVIDTPLAESAIIGTAIGAALNGLLPIPEIQFADFIHPAFDQIVNEAARIRYR
FT                   SNGAWNVQMVIRCPWGGGIHGALYHSQSVEAFFTHVPGLKVVAPSTPYDVAGLLRSSID
FT                   DPDPVLFLEHKKTYRLIKGEVPEGSRFKVPIGKAKVVRQGSDVSVFAYGLMVHQSLEAA
FT                   NLLSNEGIEAEVIDLRTLSPLDKETILNSVAKTGKALIVHEDNITGGFGAEVAAIIASE
FT                   GFEYMDGPITRLAGPDVPAIPFASTLEEAFLPNTYKIAEAIRNLAKY"
     atggcaacca aaaccgtcat acagactatt agagacacct tgtttgagga gatggagcgc        60
     gatgaaagaa tcataatcct tggggaagat gtcggtctgg ctggtggagt attcggagct       120
     acgaaaggct tacaagaaag atttggagaa tggcgagtga tcgatactcc cctggcagaa       180
     tcggccatca taggtacggc gattggagca gccttaaacg gtttactccc cattccagag       240
     atacaattcg cagattttat acacccggct tttgatcaga tagtaaacga agccgctcgc       300
     atacgttaca gatctaatgg cgcatggaat gtacagatgg ttatacgctg cccttggggc       360
     ggtggtattc atggagcgct ctatcattct cagagcgtag aggccttttt cactcatgtt       420
     ccagggctaa aagtcgttgc tccaagcact ccatacgacg tagcaggact gctccgtagc       480
     tcgatagatg acccggatcc cgtattattt ctagaacaca agaagaccta caggttgata       540
     aagggagagg tacctgaggg aagccgattc aaagtaccta taggcaaagc caaagtcgtg       600
     cgtcaaggga gtgacgtgag cgtatttgca tacgggctca tggttcatca atcactggaa       660
     gctgccaact tactctcgaa cgaggggata gaagccgagg tgattgacct taggactcta       720
     tcgcctctag ataaggaaac tatcttaaac tctgtggcca agacaggcaa agccttgata       780
     gtccacgaag ataacatcac tggtggtttc ggggctgagg tggcggcaat tatagcttca       840
     gaaggattcg agtatatgga cggccccatc acccgcctgg caggaccaga tgtacctgct       900
     attccattcg ctagcaccct cgaagaagca ttcttaccaa acacctataa aatagcggag       960
     gctattcgta accttgccaa gtactaa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page