(data stored in ACNUC7421 zone)

EMBL: CP001825.PE93

CP001825.PE93        Location/Qualifiers
FT   CDS_pept        105483..106745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0095"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: catalytic domain of components of various
FT                   dehydrogenase complexes; biotin/lipoyl attachment domain-
FT                   containing protein; E3 binding domain protein; KEGG:
FT                   bha:BH2761 branched-chain alpha-keto acid dehydrogenase
FT                   subunit E2"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41017"
FT                   /db_xref="GOA:D1CDL1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDL1"
FT                   /inference="protein motif:PFAM:PF00198"
FT                   /protein_id="ACZ41017.1"
FT                   /translation="MRITMPQLGESVVEGTIGKWFKKEGETVQEYEPLLEVITDKVSAD
FT                   YPSPITGKIVKILVPEGQTVPVGTEIAEVEIISEKEPEATAASTRSEPDESAQQQDTLT
FT                   VHLTRDKGKPHRYSPAVRRLAEEYKLDLSKIKGSGLGGRVTKKDVESYINTLESIKRNE
FT                   PEGAKVAAYKPQEIAPKPLHMLPGDEIIPLTHMRRAIADHMVQSVYTAPHVTAVIEVDM
FT                   TSIVQYRESIKDAFQKHEGIPITYLPFVVSAVAQSLREHPILNSSWSDEGIVLHKQINI
FT                   GIAVALEDGLLVPVIKQADEKNIVGLARTIYELSNKARAGKLSPEDVQGGTFTVNNPGT
FT                   FGTIISTPIIVQPQAAILTMEAIIKRPVVINDAIAIRSMMYMCLSFDHRILDGLQAARF
FT                   LQSVKKKLETFDPDKLGVGYR"
     atgcgtatca ccatgccaca gctaggggaa agcgtcgtag aaggtactat cggtaagtgg        60
     ttcaagaagg agggggaaac cgttcaggaa tatgaacccc ttctcgaggt tatcactgac       120
     aaggtcagtg ccgattaccc ctcgccaatc acaggcaaaa tagtcaagat actggttcct       180
     gaggggcaaa ctgtgccagt aggcacagag atagccgaag tagaaatcat ctccgaaaag       240
     gagccagaag caactgcagc tagcactcgc tctgagcctg acgaatcggc tcaacagcag       300
     gataccttga ccgttcacct aactagggat aagggtaagc ctcataggta ctccccagct       360
     gtaagaaggc ttgctgaaga atacaagctg gatctttcaa agatcaaggg gtctggatta       420
     gggggcaggg ttactaagaa agatgtcgag tcttatataa acaccctgga aagcattaag       480
     aggaacgaac ctgaaggcgc taaggtcgca gcttacaagc ctcaagagat tgcacccaag       540
     cctttgcata tgcttccagg ggatgagatt atacccctga ctcacatgag gcgagctata       600
     gctgatcaca tggtgcaaag cgtctatacg gctccgcatg tcacagcagt catagaggtg       660
     gatatgacca gtatcgtaca gtatagggaa agcattaagg acgctttcca aaaacacgaa       720
     ggtataccta taacttatct cccctttgtt gtgtctgccg tagcacaaag tctaagagag       780
     catccaatac tcaactcttc ctggagcgac gagggtatag tactacataa gcagataaac       840
     ataggcatag ctgtggcctt agaagacggt ctgctagtac cggtgatcaa gcaagctgat       900
     gagaaaaata tcgttggcct agcaaggact atctacgagt tatctaataa agctagggca       960
     ggtaagctat ctcctgaaga cgtccagggt ggtacattca cagtaaacaa ccctgggaca      1020
     tttggcacga taatatcgac tccaattata gtgcagcctc aggctgctat actgaccatg      1080
     gaggctataa tcaagcgtcc agtagtaatt aacgatgcta tagcaatacg ttctatgatg      1140
     tatatgtgct tatcattcga tcacagaatc ctggatggcc tacaggcagc caggttcctg      1200
     caaagcgtaa agaagaagtt agaaacattc gaccccgaca aattgggggt tggctacaga      1260
     taa                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page