(data stored in ACNUC7421 zone)

EMBL: CP001825.PE96

CP001825.PE96        Location/Qualifiers
FT   CDS_pept        108455..109741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0098"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: rso:RS05067
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41020"
FT                   /db_xref="GOA:D1CDL4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDL4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACZ41020.1"
FT                   /translation="MSTRFVALSHRDFRLLWIGQLISTIGSQMSFTAINWHIYRLLSNT
FT                   SYSIDILGRHFELGAEALGLGILGMIRVLPIIFFSMLGGMVADTHDRRQILLWTELGGA
FT                   LVSALLAITTLTGNISLGIIYLLTALSAAVSAFDTPARQAIVPQLVPKEHLTNAISLNT
FT                   LDWQIGTIIGPAIAGALIASLSIGWVYAINSLAYLMVLALILMMSFRGKPAAQETSINL
FT                   RAMFEGFRFVRNTPIIWSTMILDFWATFFSSARTMLPIVAGDLLQVGPVGYGVLSTAQS
FT                   VGSVIAGLILSLRREIHHQGIVLLVSVAIYGIATALFGVSKIFILSYILFALTGAGDTV
FT                   STVIRGTVRQILTPDHLRGRMVGVNMIFFMGGPQLGELEAGLVASVLGVPFAIVSGGVA
FT                   TVLITLWVAAKYPSLRQYKSSSEPELAIA"
     ttgagtacca ggtttgttgc gcttagccat cgtgatttca ggctgctttg gatcggccag        60
     ctgatatcaa ccataggctc gcaaatgagc tttaccgcta tcaactggca tatatatagg       120
     ctactcagca atacaagtta ttccatagac atcttaggga gacacttcga gcttggagct       180
     gaggccttag ggttggggat attaggcatg ataagagtcc tccccataat cttcttctcc       240
     atgctcggag gcatggtagc cgatacacat gacagaagac aaatactgct gtggacagaa       300
     cttggagggg cattagtatc cgcactacta gcgataacga ccctcacagg taatatatct       360
     cttggcatta tctatctatt gacagcgctt agtgcagccg tctccgcatt tgatactcct       420
     gccaggcagg caatagtccc tcaacttgtg cccaaagagc atctaactaa tgccataagt       480
     ctgaacaccc tggactggca gataggcacg atcatagggc cagctattgc cggagcacta       540
     attgcctctc taagcatagg ctgggtctat gctatcaact cattggcata cctcatggta       600
     cttgctctca ttcttatgat gagtttccga ggaaagccag ctgctcagga aacaagcatc       660
     aatctgcggg ctatgttcga ggggttcaga tttgtacgca acactcccat catatggagc       720
     actatgatcc ttgacttttg ggctacattc ttttcatcag caagaaccat gttgcccata       780
     gtagctgggg atctcctgca agtagggcct gtaggttatg gcgtactatc tacagcacaa       840
     tctgtgggtt cggtgatcgc gggcttaatt ctctccctaa gaagagagat acaccatcag       900
     ggtatagtcc tactagtaag tgttgcgatc tacggtatag ctactgcatt gttcggcgtt       960
     tccaagatct tcatactttc gtacattcta tttgcactga ctggagctgg agatacagtc      1020
     tcaacggtga ttagaggcac agtacggcag atacttaccc cagaccatct tcgaggccga      1080
     atggttgggg tcaatatgat atttttcatg ggtgggccac agctgggaga actagaggct      1140
     gggctagtag cctcagtgct gggagtgcca tttgctatcg taagtggggg tgtagccacc      1200
     gtactgatta cattgtgggt agctgctaag tatccatcac tacgacagta caagagctcc      1260
     tcagaacctg agcttgccat agcctag                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page