(data stored in ACNUC7421 zone)

EMBL: CP001854.PE1

CP001854.PE1         Location/Qualifiers
FT   CDS_pept        80..1441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: pca:Pcar_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48437"
FT                   /db_xref="GOA:D3EYP9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYP9"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADB48437.1"
FT                   /translation="MHTQLEHTWSQIQAELRRAVTDSTYHLWLAPLKARSLDGDVLMVG
FT                   APEEIRTWVADRFARVLQTCAAAVISPATTIVVVPLDAPLPAEADARPAAPPPRPSEAK
FT                   ADESFNPKYTFDQFVIGDGNRLAHAAALAVAELPGQAYNPLFIYGPPGLGKTHLLHAIA
FT                   NYVRSYGDGMTVRYTTIEAFTNRFITALRSSSVEEFKRRYRDTDILLIDDVQFLQSKAK
FT                   TEEEFFHTFNALYETGSQLVVTCDRMPRDMNALAERLRERFESGLVTDIRAPDLATRMT
FT                   ILRKRVQHDGVQLASPDAIEPIADRITTNIRALQGALIRVVAFHSLTGRPIDRALVTHV
FT                   LDGLYPGARPQQRTLAEIQEATCERLGVSPEALRSPDRSARVAWARQVAMYLARELTDE
FT                   TLPAIGRAFGGRNHTTVMHACRRASERIAADAEAYELVRALTARLQQPDADRGS"
     gtgcacacgc agctcgagca cacctggtcc cagatccaag ccgagctccg gcgtgccgtc        60
     accgactcga cgtatcacct ctggctcgcg ccgctgaagg cgcgctcgct cgacggcgac       120
     gtcctgatgg tcggcgcgcc cgaggagatc cgcacgtggg tcgcggaccg cttcgcccgc       180
     gtcctgcaga cctgcgcagc cgccgtcatc agcccggcga cgacgatcgt cgtcgtcccg       240
     ctggacgccc cgctcccggc ggaggccgac gcgcggcccg ccgccccgcc gccgcgcccg       300
     tccgaggcga aggccgacga gagcttcaac cccaagtaca cgttcgacca gttcgtcatc       360
     ggcgacggca accgcctcgc ccacgcggcg gcgctcgccg tcgccgaact gccggggcag       420
     gcgtacaacc cgctcttcat ctacggtccg cccggcctcg gcaagaccca cctgctgcac       480
     gcgatcgcca actacgtgcg ctcctacggc gacgggatga ccgtccgcta cacgacgatc       540
     gaggcgttca cgaaccgctt catcaccgcg ctcagatcga gctccgtcga ggagttcaag       600
     cggcgctacc gcgacaccga catcctcctg atcgacgacg tccagttcct ccagagcaag       660
     gcgaagacgg aggaggagtt cttccacacg ttcaacgcgc tctacgagac cggcagccag       720
     ctcgtcgtca cgtgcgaccg catgccgcgc gacatgaacg cgctcgccga gcggctgcgc       780
     gagcggttcg agtccggact cgtcaccgac atccgcgccc ccgacctcgc gacgcgcatg       840
     acgatcctgc gcaagcgcgt ccagcacgac ggcgtccagc tcgcctcgcc cgacgcgatc       900
     gagccgatcg ccgaccgcat cacgacgaac atccgcgcgc tccagggcgc gctgatccgg       960
     gtcgtcgcgt tccactcgct gacgggcaga ccgatcgacc gcgcgctcgt cacgcacgtg      1020
     ctcgacggcc tctaccccgg tgcgagaccg cagcagcgga cgctcgccga gatccaggag      1080
     gcgacgtgcg agcgcctcgg cgtctcgccc gaagcgctgc gctcgccgga ccgcagcgcc      1140
     cgcgtcgcct gggcccgtca ggtcgcgatg tacctcgcgc gcgagctgac cgacgagacg      1200
     ctgcccgcga tcggccgcgc cttcggcggc cgcaaccaca cgaccgtgat gcacgcgtgc      1260
     agacgcgcca gcgagcggat agccgccgac gccgaggcct acgagctcgt gcgggcgctg      1320
     acggcccgcc tccagcagcc cgatgccgac cggggttcct ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page