(data stored in ACNUC7421 zone)

EMBL: CP001854.PE10

CP001854.PE10        Location/Qualifiers
FT   CDS_pept        complement(11814..12941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0010"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48446"
FT                   /db_xref="GOA:D3EYP2"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYP2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48446.1"
FT                   /translation="MSFFDEADEPRTTPRPRRAPSGGGSRRPPTDEQTLLVRRLVAAGA
FT                   VVVVLVLMVVLVRGCVGSRREQALKDYNRDVRTLVQQSVRSVSDRLFETLSGAGGQQAE
FT                   QVNEAINQLRVVAEDQLQQAEALDVPGSAKEAQSDLELVLSLRHDGVREIAEQIQTALG
FT                   NSPQSGAAVDAITAQMQAFNASDVVYSQRVAPLILKALKDDGIAASYDGTAGEQVAPYS
FT                   QFLPNVSWMDASNVARALGTSSASADETGRPAPGLHGHQIDSVSVGGTALEPGTSVTLP
FT                   ASPAPTFEVAFTNGGEHDEQNVRVVVEISVGGATPLRAETTVPSTTAGEPATANVEFRE
FT                   SPPTTGAAEVRVTIEPVPGEEGLDNNTATYTALFE"
     ttgtcgttct tcgacgaggc tgacgagccg cgcacaacgc cccggccacg ccgcgctccg        60
     tccgggggcg gcagccgccg accgccgacc gacgagcaga ccctgctcgt gcggcgtctc       120
     gtggccgccg gagccgtggt cgtcgtcctc gtcctgatgg tggtgctggt gcgcggatgc       180
     gtgggcagca gacgagagca ggccctgaag gattacaacc gcgacgtccg gacgcttgtc       240
     cagcagtccg tcagatcggt cagcgaccgt ctcttcgaga cgctctcggg cgccggcggc       300
     cagcaggcgg agcaggtcaa cgaggcgatc aaccagctcc gcgtcgtcgc cgaagatcag       360
     ctgcagcagg ccgaggcgct cgacgtgccg ggctccgcca aggaggcgca gagcgatctg       420
     gagctggtgc tgtcgctgcg ccacgacggc gtcagagaga tcgctgagca gatccagacg       480
     gcgctcggaa actcgccgca gtcgggcgcc gctgtcgacg cgatcaccgc gcagatgcag       540
     gcgttcaacg cctccgacgt cgtctactcg cagcgcgtcg cgccgctgat cctgaaggcg       600
     ctcaaggacg acggcatcgc cgccagctac gacggcaccg ccggcgagca ggtcgcgccg       660
     tactcgcagt tcctcccgaa cgtcagctgg atggacgcct cgaacgtcgc gagagcgctc       720
     ggcaccagca gcgccagcgc cgacgagacc ggcagaccgg ctccgggcct gcacggccac       780
     cagatcgact ccgtcagcgt cggcggcacc gcactggaac cgggcacgtc ggtgacactg       840
     cccgccagcc cggcgccgac gttcgaggtc gcgttcacca acggcggcga gcacgacgag       900
     cagaacgtca gagtcgtcgt cgagatctcc gtcggcggcg cgacgccgct gagagcggag       960
     acgaccgtgc cctcgacgac cgcgggcgag cccgcgaccg ccaacgtcga gttcagagaa      1020
     tcgccgccga ccaccggcgc cgccgaggtc agagtcacga tcgagcccgt cccgggcgag      1080
     gagggactcg acaacaacac cgcgacgtac accgcgctct tcgagtga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page