(data stored in ACNUC7421 zone)

EMBL: CP001854.PE100

CP001854.PE100       Location/Qualifiers
FT   CDS_pept        complement(97286..98143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0100"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: glo:Glov_1002
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48536"
FT                   /db_xref="GOA:D3F4V8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4V8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADB48536.1"
FT                   /translation="MAFFEHDGQRIAYAEHGAGPRAVVLLPGLLFSQRMQEPLAEALAA
FT                   RGNRVITMDPLGHGRSDRPRDMWRYSMSSFGGQVIGLLDHLELEQAVVGGASLGANVTL
FT                   EVAAAAPERLRGMVLEMPVLDNALLGCAIGFTPLLVSLTFGEPAMKLVQHVAKRVPRSP
FT                   LPFIPEILLDWVSQDPGPSAAVLQGLFFGRIAPHRDVRRTFKTPSLVIGHRRDPIHPFS
FT                   DADMLVQELEHGRLLNADSILELRTHPERLTGEIGDFLDECWRPRRAARRRAPRSRARP
FT                   RATA"
     atggcgttct tcgagcacga cggccagcga atcgcctacg ccgagcacgg cgcggggccg        60
     cgcgccgtcg tcctgctgcc ggggctgctg ttctcgcagc ggatgcagga gccgctggcg       120
     gaggcgctcg cggcacgcgg caaccgcgtg atcacgatgg acccgctcgg ccacggcaga       180
     tcggaccgtc cgcgcgacat gtggcgctac tcgatgtcgt cgttcggcgg ccaggtgatc       240
     ggcctgctcg accacctgga gctcgagcag gcggtcgtcg gcggagcgtc gctcggcgcc       300
     aacgtgacgc tggaggtcgc cgccgccgcg cccgagcggc tgcgcgggat ggtgctggag       360
     atgcccgtgc tcgacaacgc gctgctcggc tgcgcgatcg gcttcacccc gctgctcgtg       420
     tcgctgacgt tcggcgagcc ggcgatgaag ctcgtccagc acgtcgccaa gcgggtgccg       480
     cgcagccccc ttccgttcat cccggagatc ctgctcgatt gggtctcgca ggacccgggc       540
     ccgagcgctg ccgtgctgca gggactgttc ttcggtcgca tcgccccgca ccgcgacgtg       600
     cggcggacgt tcaagacgcc gtcgctggtg atcggccacc ggcgcgatcc gatccacccg       660
     ttctccgacg cagacatgct cgtgcaggag ctggagcacg ggcggctgct gaacgccgac       720
     tcgatcctcg agctgcgcac gcaccccgag cggctgacgg gcgagatcgg cgacttcctc       780
     gacgagtgct ggcggccgcg cagagcggcg agacggcggg cgccgcggtc tcgcgcacgg       840
     ccgcgcgcga ccgcctga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page