(data stored in ACNUC7421 zone)

EMBL: CP001854.PE101

CP001854.PE101       Location/Qualifiers
FT   CDS_pept        complement(98156..98974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0101"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   dma:DMR_30730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48537"
FT                   /db_xref="GOA:D3F4V9"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4V9"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB48537.1"
FT                   /translation="MSVTGETDLREAPAPDPGFAIRFLDAGNALRGIRALKPVMLELLA
FT                   LRRGMHVLELGCGAGDDVRAFGRRVGSAGRVLGIDEAPSMVEEAARRSHGRNLPVEFQV
FT                   GDALALDLPDATFDRVRIERLLMHVDGEPATVLRESARVLRDGGRIVVFDFDWDALVIE
FT                   GADRELTRRIVRSYADAIRNGSVGRALPRLLNEAGFTSVSTVPHGVAIPYDFFGWLVSS
FT                   HLDEALAAGLFTPEELIAWWDELDRAHAAGGFFAALLGFVAAGTKAPAAG"
     gtgagcgtga ccggcgagac cgatctgcgc gaggcgcccg ccccggaccc cggcttcgcg        60
     atccgcttcc tcgacgccgg caacgcgctg cgcggaatcc gcgcactgaa gccggtgatg       120
     ctcgagctgc tggcgctgcg gcggggaatg cacgtgctgg agctgggctg cggcgccggc       180
     gacgacgtgc gcgcgttcgg ccggcgcgtc ggcagcgccg ggcgggtgct cgggatcgac       240
     gaggcgccgt cgatggtcga ggaggcggcg cggcgctcac acggccgcaa cctgccggtc       300
     gagttccagg tcggcgacgc gctcgcgctc gacctgccgg acgcgacgtt cgaccgcgtg       360
     cggatcgagc ggctgctgat gcacgtcgac ggcgagcccg cgaccgtgct gcgcgagagc       420
     gcgcgcgtgc tgcgcgacgg cggccggatc gtcgtcttcg acttcgactg ggacgcgctc       480
     gtgatcgagg gggccgaccg cgagctgacg cgccggatcg tccgcagcta cgccgacgcg       540
     atccgcaacg gctccgtcgg gcgggcgctg ccgcggctgc tgaacgaagc cggcttcacg       600
     tcggtctcga ccgtcccgca cggcgtcgcg atcccctacg acttcttcgg ctggctcgtc       660
     tccagccacc tcgacgaggc gctcgccgcc gggctgttca cacccgagga gctgatcgcg       720
     tggtgggacg agctcgaccg cgcccacgcc gccggcggct tcttcgccgc gctgctcggc       780
     ttcgtcgcgg ccgggacgaa agcaccggcg gcggggtag                              819
//

If you have problems or comments...

PBIL Back to PBIL home page