(data stored in ACNUC7421 zone)

EMBL: CP001854.PE102

CP001854.PE102       Location/Qualifiers
FT   CDS_pept        complement(98971..99840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0102"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: maq:Maqu_2428
FT                   haloalkane dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48538"
FT                   /db_xref="GOA:D3F4W0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W0"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADB48538.1"
FT                   /translation="MRTPEDRFAGLPDFPFEAHYRELDGLRLAHLDEGDGPPVLLMHGE
FT                   PTWSFLWRHAVAPLRDAGYRAIVPDHAGFGRSDKPTELEWYSYDRHTSIAAELLERLDL
FT                   RDVTVVVHDWGGPIGLRLAVEQPERIARIVVTDTGLFTGRQRMTPAWEAFRGFVEATED
FT                   LPIGMLVRGGCHRDPGDAVVAAYDAPFPDAASKAGARAFPLLIPRTPDEAGAATGQRTL
FT                   DALAADTRPTLVLWAEHDPIIPLRTGERFAQAIGAEVAHVVPDASHFLQEDQGPLVGRL
FT                   IVEWLGST"
     gtgcggacgc cggaggaccg gttcgccggg ctgccggact ttccgttcga agcccactac        60
     cgcgagctgg acggcctccg gctcgcgcac ctcgacgagg gcgacgggcc gccggtgctg       120
     ctgatgcacg gcgagccgac ctggtcgttc ctgtggcgtc acgcggtcgc gccgctgcgc       180
     gacgccggtt accgcgcgat cgtccccgac cacgccggct tcggtcgctc ggacaagccg       240
     acggaactgg agtggtacag ctacgaccgc cacacctcga tcgcggcgga gctgctcgaa       300
     cggctcgacc tgcgcgacgt gacggtcgtc gtgcacgact ggggcgggcc gatcgggctg       360
     cggctcgccg tcgagcagcc ggaacggatc gcgcggatcg tcgtgaccga caccgggctg       420
     ttcaccggcc gccagcggat gacaccggcg tgggaggcgt tccgcggctt cgtcgaggcg       480
     accgaggacc tgccgatcgg gatgctcgtc agaggcggct gccaccgcga ccccggagac       540
     gccgtcgtcg cggcgtacga cgcgccgttc cccgacgccg cctcgaaggc cggtgcacgc       600
     gccttcccgc tgctgatccc gcgcacgccc gatgaggccg gcgcggcgac cggccagcgg       660
     acgctcgacg cgctcgccgc cgacacacgc ccgacgctcg tgctgtgggc agagcacgat       720
     ccgatcatcc cgctcagaac cggcgagcgg ttcgcgcagg cgatcggcgc ggaggtcgcc       780
     cacgtcgtgc cggacgcaag ccacttcctg caggaggacc agggcccgct cgtcgggcgg       840
     ctgatcgtcg agtggctggg cagcacgtga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page