(data stored in ACNUC7421 zone)

EMBL: CP001854.PE103

CP001854.PE103       Location/Qualifiers
FT   CDS_pept        100056..102044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0103"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase central
FT                   region; Transketolase domain protein; KEGG: dal:Dalk_2752
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48539"
FT                   /db_xref="GOA:D3F4W1"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W1"
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /protein_id="ADB48539.1"
FT                   /translation="MATTAQSTEQLAVDTIRTLAMDAVQNTGNGHPGMPMGMAPVGYLL
FT                   FSEVMRHNPTDPHWPDRDRFVLSAGHGSMLLYACLHLSGYDVTMDDIKHFRQWGSRTPG
FT                   HPEVHHTPGVETTTGPLGQGFANAVGMAIAERFLREHFGAEVQDHRIYGICSDGDLMEG
FT                   VSAEAASLAGHLGLGHLIFLYDHNHISIDGHTSLTFDTEDVNERFDAYGWHTQDVDDVT
FT                   DLDALRAAIAAAQQETGRPSLIRVRSKIGYPAPNKQDTPGAHGAALGEDEVRATKEVMG
FT                   WDPDQHFVVPDGVYDLFSAVEDGKRHQAAWEERYQSWRAADGERATRWDLAWAGKPLPG
FT                   LDAALPQFDPADKPSLATRSAGGTTLQTIARFLPTMVGGSADLNESVKTGIAADGPYSR
FT                   EQATRNVYWGIREHAMGAAVNGLALHGGIVKPYGGTFLQFADYMRPALRLSALMHLPVV
FT                   WVYTHDSVALGEDGPTHQPVEHLAALRAIPGLTLIRPSDANETAEAWRVAVEDVDGPVV
FT                   LVLTRQNVPTLERPPYAPAKGIDKGAYVLADADDAVATIVGTGSEVSVALGARDLLAAE
FT                   GVAARVVAMPSWELFEAQDQAYRDEVLPPGQPKVAVEAGIAMGWERWVDATVSIERFGA
FT                   SAAGEKILEEYGITAAAVAERVRSLLT"
     atggccacca ccgcacagtc caccgagcaa ctcgccgtcg acaccatccg cacgctcgcg        60
     atggatgccg tgcagaacac cggcaacggc caccccggca tgccgatggg catggcgccg       120
     gtcggctacc tcctcttctc cgaggtgatg cggcacaacc cgaccgaccc gcactggccc       180
     gaccgcgacc gcttcgtgct gtcggccggc cacggctcga tgctgctcta cgcctgtctg       240
     cacctgtcgg gctacgacgt gacgatggac gacatcaagc acttccgcca gtggggctcg       300
     cgcacgccgg gtcacccgga ggtgcaccac acgccgggcg tcgagacgac gaccggcccg       360
     ctcggccagg gcttcgcgaa cgcggtcggc atggcgatag cggagcgctt cctgcgcgag       420
     cacttcggcg ccgaggtcca ggaccaccgc atctacggca tctgctccga cggcgacctg       480
     atggagggcg tcagcgccga ggccgcctcg ctcgccggtc acctcgggct cgggcacctg       540
     atcttcctct acgaccacaa ccacatctcg atcgacggcc acacgtcgct gacgttcgac       600
     accgaggacg tcaacgagcg cttcgacgcg tacggctggc acacgcagga cgtcgacgac       660
     gtcaccgacc tcgacgcgct gcgcgccgcg atcgccgccg cccagcagga gacggggcgc       720
     ccgtcgctga tccgcgtcag atcgaagatc ggctacccgg cgccgaacaa gcaggacacc       780
     cctggcgccc acggcgcggc gctcggcgag gacgaggtgc gcgcgacgaa ggaggtcatg       840
     ggctgggatc ccgaccagca cttcgtcgtg ccggacggcg tctacgacct cttcagcgcg       900
     gtcgaggacg ggaagagaca ccaggccgcc tgggaggagc gctaccagag ctggcgcgcc       960
     gccgacggcg agcgcgcgac gcgctgggac ctcgcgtggg ccggcaagcc gctgcccggt      1020
     ctcgacgcgg cgctgccgca gttcgaccct gccgacaagc cgtcgctggc gacgcgctct      1080
     gccggcggca cgacgctgca gacgatcgcg cggttcctgc cgacgatggt gggcggctcg      1140
     gccgacctca acgagagcgt caagaccggc atagcggccg acggccccta ctcgcgcgag      1200
     caggcgacgc gcaacgtcta ctggggcatc cgcgagcacg cgatgggcgc cgcggtcaac      1260
     ggcctggcgc tgcacggcgg catcgtcaag ccgtacggcg ggacgttcct ccagttcgcc      1320
     gactacatgc gcccggcgct gcggctgtcc gcgctgatgc acctgccggt cgtgtgggtc      1380
     tacacgcacg actctgtcgc gctcggcgag gacggcccga cgcaccagcc ggtcgagcac      1440
     ctcgccgcgc tgcgcgcgat cccgggcctg acgctgatcc gtcccagcga cgcgaacgag      1500
     acggccgagg cgtggcgcgt cgcggtcgag gacgtcgacg gcccggtcgt gctggtcctc      1560
     acgcgccaga acgtgccgac gctggagcgc ccgccgtacg ccccggcgaa ggggatcgac      1620
     aagggcgcct acgtgctggc cgacgccgac gacgccgtcg cgacgatcgt cgggaccggc      1680
     tccgaggtct ccgtcgcact cggcgcgcgc gacctgctcg ccgccgaggg cgtcgccgcc      1740
     cgcgtcgtcg cgatgccgag ctgggagctg ttcgaggcgc aggaccaggc ataccgcgac      1800
     gaggtcctgc cgcccggcca gccgaaggtc gcggtcgagg cggggattgc gatgggctgg      1860
     gagcgctggg tcgacgcgac cgtctcgatc gagagattcg gcgcgtcggc ggccggcgag      1920
     aagatcctcg aggagtacgg catcaccgcg gccgcggtgg ctgagcgggt gcgctcgctg      1980
     ctgacgtag                                                              1989
//

If you have problems or comments...

PBIL Back to PBIL home page