(data stored in ACNUC7421 zone)

EMBL: CP001854.PE104

CP001854.PE104       Location/Qualifiers
FT   CDS_pept        102150..102641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: net:Neut_1851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48540"
FT                   /db_xref="InterPro:IPR025325"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48540.1"
FT                   /translation="MSEATVVGSAPDLVPGSVSLRGDAAAWDRLEQQVAWYDARSRHSQ
FT                   RWFKLLKVCQIVIAAAIPVVAGAGGDGWRWPVAIGGATIVVLEGLQQLFQYQQNWSTYR
FT                   STCERLKHEKFLYAAGAGPYAGASRPGAMLAERVEGLVSQEHAAWASVQRHRQDEERTA
FT                   "
     gtgagcgagg cgacagtggt cggatcggcg ccggatctgg tgccgggcag cgtcagcttg        60
     cgcggcgacg ccgcggcatg ggaccggctc gaacagcagg tcgcgtggta cgacgcgcgc       120
     agccggcaca gtcagcgctg gttcaagctg ttgaaggtct gccagatcgt gatcgccgcg       180
     gcgatccccg tcgtggcggg cgcgggcggc gacggctgga gatggccggt cgcgatcggc       240
     ggcgcgacga tcgtcgtgct ggaggggctc cagcagctgt tccagtacca gcagaactgg       300
     tccacctacc gctcgacgtg cgagcggctc aagcacgaga agttcctcta cgcggccggt       360
     gccggaccct acgcgggcgc gtcgcggccg ggtgcgatgc tggccgagcg ggtcgaaggg       420
     ctcgtctctc aggagcacgc cgcgtgggcg tcggtccagc gccatcggca ggacgaggag       480
     agaacggcgt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page