(data stored in ACNUC7421 zone)

EMBL: CP001854.PE105

CP001854.PE105       Location/Qualifiers
FT   CDS_pept        102638..103825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0105"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_1196 PASTA"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48541"
FT                   /db_xref="GOA:D3F4W3"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48541.1"
FT                   /translation="MSAAAPKVFLSYRREETAGHAGRLYDAIATRFGDANVFMDVELAP
FT                   GIDFVDRITEAVGECRALLVVIGPRWASVTAAGRPQPRIAEPGDYVRLEVETALARSDV
FT                   RVIPVLVAGARMPPPAQLPPSLQGLARRNAIELSDLRWRYDVGRLSDTLGELVAGASAD
FT                   DEGEPHAIAATAARSGPAAARSGPAAAPQTGSASLVLLLLEAIALAAAAGMLARLLAEP
FT                   IHADALASDAEHIATLVLRRAVTWAIVGAVLGVWLSVRRGERSQTVGRLLGGFVLGAAA
FT                   GALGGAIFGAAVILPAEPVAREVADRISIGAMAATGAVLGAAIGALWTPRRVAVGLLAG
FT                   AAGGVVVQLLRNQLGQPSDVVAVGFQCVGIVGFAVSAQLFLDVRAAAVSRQPVRA"
     gtgagcgcgg cggcgccgaa ggtcttcctc agctaccgcc gcgaggagac cgccggccac        60
     gccggccgcc tctacgacgc gatcgcgacc cgcttcggcg atgccaacgt cttcatggac       120
     gtcgagctgg cgcccgggat cgacttcgtc gaccggatca cggaggcggt cggcgagtgc       180
     cgtgcgctgc tcgtcgtgat cgggccgcgg tgggcgtcgg tcacggcagc cggccggccg       240
     cagccgcgca tcgccgagcc cggcgactat gtccgtctcg aggtcgagac cgcgctcgcg       300
     cgcagtgacg tgcgggtcat cccggtgctc gtcgccggcg cgcggatgcc gccgcccgcg       360
     cagctcccgc cgtcgctgca gggactcgcg cggcgcaacg cgatcgagct gagcgacctg       420
     cgctggcgct acgacgtcgg ccggctgtcg gacacgctcg gcgagctggt ggccggcgcg       480
     agcgctgacg acgagggcga gccgcacgcg atcgcggcga cggccgctcg gtccggcccg       540
     gcggctgctc ggtccggtcc ggcggccgcg ccgcagaccg gctcggcgag cctcgtcctg       600
     ctgctgctcg aggcgatcgc gctggccgcc gccgcgggga tgctcgctcg actgctggcc       660
     gagccgatcc acgcggacgc gctcgcgtcc gacgccgagc acatcgcgac gctcgtgctg       720
     cgccgcgccg tgacgtgggc gatcgtcggc gcggtgctcg gcgtgtggct gagcgtccgc       780
     cggggtgagc gcagtcagac cgtcggccgg ctgctcggcg ggttcgtgct cggcgcggcc       840
     gccggtgcgc tcggcggggc gatcttcggc gcggccgtga tcctgccggc ggagccggtc       900
     gcgcgtgagg tcgcagaccg catctcgatc ggcgcgatgg cggccaccgg cgcggtcctc       960
     ggcgcggcga tcggcgccct gtggaccccg cggcgggtcg cggtggggct gctcgccggc      1020
     gcggccggcg gcgtcgtcgt gcagctgctg cgcaaccagc tcggccagcc gagcgacgtc      1080
     gtcgcggtcg gcttccagtg cgtcgggatc gtcggcttcg ccgtctccgc gcagctgttc      1140
     ctcgacgtgc gtgcggcggc cgtcagccgc cagcctgtcc gcgcatga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page