(data stored in ACNUC7421 zone)

EMBL: CP001854.PE106

CP001854.PE106       Location/Qualifiers
FT   CDS_pept        complement(103800..105287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0106"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   bxe:Bxe_B2926 putative transglycolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48542"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W4"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ADB48542.1"
FT                   /translation="MPTTRRRRTSPASPSPSRLRLLLAALVLVGVVALVLTQRDGGGGG
FT                   DAEPLPSAGRAAGSGHDPFAFDPSRAELFEQRAAFGTAHPLYTKSPGGAIASAERVARL
FT                   RPLIDQATEGTDVDPDTLEAMVFLESAGRPDAIAGGTDLAGAVGLTQILAETGTSMLGM
FT                   RVDVAASTRLTRRLQRAVNRGDDARAARLAAERRRVDERFDPRKALAGTIRYLDFARER
FT                   LGRDDLTVVSYHMGVGNLENAIEAFGGGRPSWTELYFGSSPTQNPEVWRLFAGLGDESS
FT                   LYYWKVRAARDLMALYRSDPEALDKLAALQTAKASNENVLHPPAAGEAFADGGALRAAY
FT                   DDGRLVRLPTNAGELGLRIDRQMGELAGRVGQPRALYRGLRPDALRLLVEIAAGTRRIS
FT                   GVDAPLTVTSTVRDQRYQEQLAGGNPEATHAFSVHTTGWSFDILRRYANDRQALALQFM
FT                   LDRLQTLGLIAWVREPAAIHVTVAGDAVRFMRGQAGG"
     gtgccgacga cccgccgccg tcgaacctca cccgcgtccc cgtcgcccag ccgcctgcgg        60
     ctgctgctcg cggcgctcgt gctcgtcggc gtcgtcgcgc tcgtgctgac acagcgcgac       120
     gggggcggcg gcggtgacgc ggagccgctg ccgagcgccg ggcgagcggc cggaagcgga       180
     cacgacccgt tcgcgttcga ccccagccgg gctgagctgt tcgagcagcg tgccgcgttc       240
     ggcaccgcgc atccgctcta cacgaagagc cccggtggcg cgatcgcctc ggccgagcgc       300
     gtcgcgcggc tgcgaccgct gatcgaccag gcgaccgagg gcaccgacgt cgaccccgac       360
     acgctcgagg cgatggtctt cctcgagagc gccggacggc ccgacgcgat cgccgggggc       420
     accgacctcg ccggcgcggt cggcctcacg cagatcctcg cggagaccgg caccagcatg       480
     ctcgggatgc gcgtcgacgt cgccgccagc acgcggctga cgcgccggct ccagcgggcg       540
     gtgaaccgcg gcgacgacgc gcgggccgcg cggctggccg ccgagcggcg acgcgtcgac       600
     gagcgcttcg acccgcgcaa ggcgctcgcc ggcacgatcc gctacctcga cttcgcgcgt       660
     gagcggctcg ggcgcgacga cctgacggtc gtctcctacc acatgggcgt cggcaatctc       720
     gagaacgcga tcgaggcgtt cgggggcggg cggccgagct ggaccgagct gtacttcggc       780
     agctccccga cgcagaaccc ggaggtctgg agactgttcg ccggcctcgg agacgagtcg       840
     tcgctgtatt actggaaggt gcgtgccgcg cgcgacctga tggcgctcta tcgcagcgac       900
     cctgaggcgc tcgacaagct cgccgcgctg cagacggcga aagcctccaa cgagaacgtg       960
     ctgcatccgc ccgctgccgg cgaggcgttc gcggacggcg gcgcgctgcg ggccgcctac      1020
     gacgacgggc gactcgtgcg gctgccgacc aacgccggcg agctcggcct gcggatcgac      1080
     cggcagatgg gcgagctggc cggcagagtc ggccagcccc gcgcgctcta ccgcggcctg      1140
     cggcccgacg cgctgagact gctcgtcgag atcgccgccg gcacgcgccg gatctccggc      1200
     gtcgatgcgc cgctgaccgt cacgagcacg gtgcgcgacc agcgatacca ggagcagctc      1260
     gccggcggga acccggaggc gacccacgcg ttctcggtgc acacgaccgg ttggtcgttc      1320
     gacatcctgc gccgctacgc gaacgaccgc caggcgctcg cgctccagtt catgctcgac      1380
     cggctgcaga ccctggggct gatcgcatgg gtgcgcgagc cggccgcgat ccacgtcacc      1440
     gtcgcgggcg acgccgtccg cttcatgcgc ggacaggctg gcggctga                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page