(data stored in ACNUC7421 zone)

EMBL: CP001854.PE107

CP001854.PE107       Location/Qualifiers
FT   CDS_pept        105517..105798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0107"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: dol:Dole_0936 XRE
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48543"
FT                   /db_xref="GOA:D3F4W5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADB48543.1"
FT                   /translation="MHHKRTSRTPVSAEHVVLGRAVRELRARRDLSQEQLGFHSGLHRN
FT                   YVGAIERGEINPTFKTLLSLVRGLDLPLSELVLLYEHCRAERHGRRHG"
     atgcaccaca agcgtacttc ccgcacgccg gtctcggcgg agcacgtcgt cctcggcaga        60
     gccgtccgtg agctgcgcgc ccgccgcgac ctctcccagg agcagctcgg cttccactcc       120
     ggcctgcacc gcaactacgt cggcgcgatc gagcgcggcg agatcaatcc gaccttcaag       180
     acgctgctct cgctcgtccg cggactcgac cttccgctct cggagctggt cctgctctac       240
     gagcactgcc gcgccgagcg gcacgggcgg cggcacggat ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page