(data stored in ACNUC7421 zone)

EMBL: CP001854.PE108

CP001854.PE108       Location/Qualifiers
FT   CDS_pept        105828..106691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0108"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   tdn:Suden_1355 site-specific DNA- methyltransferase
FT                   (adenine-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48544"
FT                   /db_xref="GOA:D3F4W6"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W6"
FT                   /inference="protein motif:PFAM:PF01555"
FT                   /protein_id="ADB48544.1"
FT                   /translation="MRVLSTGELPERIELGGEDLVVHGDNLDVLPLLPDGAFDMIYIDP
FT                   PFNTGKAQRRRTLVFEPDVEGDRTGFGGRRYRSQLLQALAYGDTFDDYLGFVAPRLEHA
FT                   RRLLAEHGTLYFHIDYREAHYCKLLLDEIFGRDCFLNEIIWAYDYGGKPRSRWPAKHDT
FT                   ILVYVRTPGAHHFDAEAVDREPYMAPGLVTPEKVARGKRPTDVWWHTIVPTNGYEKTGY
FT                   PTQKPAGVVRRMVAASSRPGGWCLDFFAGSGTLGAVAAGLGRRYVLVDSHAEAIDVMRK
FT                   RLGTAE"
     atgcgcgtgc tgagcaccgg cgagttgcct gaacggatcg agctgggggg agaggatctc        60
     gtcgtccacg gcgacaacct cgacgtcctg ccgctgctgc ccgacggcgc gttcgacatg       120
     atctacatcg atccgccgtt caacacgggc aaggcgcagc ggcgccgcac gctcgtgttc       180
     gagcccgacg tggagggcga ccggaccggc ttcggcgggc ggcgctaccg ctcgcagctg       240
     ctgcaggcgc tcgcgtacgg cgacacgttc gacgactacc tcggcttcgt cgcgccgcgg       300
     ctggagcacg cccgccggct gctcgccgag cacggcacgc tgtacttcca catcgactac       360
     cgcgaggcgc actactgcaa gctgctgctc gacgagatct tcgggcgcga ctgcttcctc       420
     aacgaaatca tctgggcgta cgactatggc ggcaagccga gatcgcgctg gccggcgaag       480
     cacgacacga tcctggtcta cgtccgcaca cccggcgccc atcacttcga cgccgaggcg       540
     gtcgaccgcg agccgtacat ggcgccgggg ctcgtcacgc cggagaaggt cgcacgtggc       600
     aagcgcccga ccgacgtctg gtggcacacg atcgtgccga cgaacgggta cgagaagacc       660
     ggctacccga cgcagaagcc ggcgggggtc gtccggcgga tggttgccgc ctcatcgaga       720
     ccgggcggct ggtgcctcga cttcttcgcc ggctccggca cgctcggcgc cgtcgccgcc       780
     ggcctcggcc ggcgctacgt gctcgtcgac tcgcacgcgg aggcgatcga cgtgatgcgc       840
     aagcggctgg gaaccgcgga gtag                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page