(data stored in ACNUC7421 zone)

EMBL: CP001854.PE109

CP001854.PE109       Location/Qualifiers
FT   CDS_pept        complement(106711..107400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0109"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; SMART: regulatory protein GntR HTH; KEGG:
FT                   bxe:Bxe_B2016 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48545"
FT                   /db_xref="GOA:D3F4W7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W7"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADB48545.1"
FT                   /translation="MVKLPAPRLQPVDDKNLADRVADQLRETIQSGGYAPGERLVERRL
FT                   ASELGVSHIPVREALTRLTEEGLVERLPRRGCRVAAVSAKDLRDLSSLRVLLEQYVAER
FT                   AQENWTPRAERSLRELVAQMEAAADRGDTSRLSDLDVRFHEQLWALTDHEILVDLVSQL
FT                   RGRISGFLRAATNALEPEALRAHAASHGELIDAIASGKSGKARRAMAKHVEDAAKRLQE
FT                   NAPPEAG"
     gtggtcaaat tgcctgctcc ccgccttcag ccggttgatg acaagaacct cgccgaccgg        60
     gtcgccgacc aattgcgcga gacgatccag agcggcggct acgcccccgg cgagcgcctc       120
     gtcgagcgca gactcgcgag cgagctgggc gtcagccaca tccccgtgcg cgaggcgctg       180
     acgcgcctga ccgaggaggg cctggtcgag cggctgcccc gccgcggctg ccgcgtcgcc       240
     gcggtcagcg cgaaggacct gcgcgacctg tcgagcctgc gcgtgctgct ggagcagtac       300
     gtcgccgagc gggcgcagga gaactggacg ccgagagccg agcgttcgct gcgcgagctg       360
     gtggcgcaga tggaggcggc ggccgaccgc ggcgacacca gccgcctgtc cgacctcgac       420
     gtccgcttcc acgagcagct gtgggcgctg accgatcacg agatcctcgt cgacctcgtc       480
     tcgcagctgc gcggccgcat cagcggcttc ctgcgcgcgg cgacgaacgc gctcgaaccg       540
     gaggcgctgc gcgcgcacgc cgcgtcgcac ggcgagctga tcgacgcgat cgcgagcggc       600
     aagtccggca aggcaagacg cgcgatggcc aagcacgtcg aggacgcggc gaagcgcctc       660
     caggagaacg cgccgcccga ggccgggtag                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page