(data stored in ACNUC7421 zone)

EMBL: CP001854.PE11

CP001854.PE11        Location/Qualifiers
FT   CDS_pept        13057..15213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0011"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: scl:sce0850 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48447"
FT                   /db_xref="GOA:D3EYP3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYP3"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADB48447.1"
FT                   /translation="MEHRNVTGGDASTVRLRGEGPRPPDAAPLVLERYRLLRQLGAGAF
FT                   GTVWLAHDERLARDVAVKAIALDHASGRAEQEARAAARLAHPAIVTLYEAGTEDGSTYL
FT                   VTELVRGGTLAELLAEGALSDRDVAEVGIALCQGLAHAHAQGVVHRDVKPSNVLVPDAP
FT                   HAGGPVAKLTDFGVARIVEGAGGDALTRTGDVVGTLAYMAPEQAEGREAGAPADLYAAA
FT                   LVLYEALSGVNPIRGGTAVATARRLGATLPPLERQRRDLPPDLCDAIDRALLPRPGERG
FT                   TVAHLHRALRAALPQLGDEPGTVEAPHVERFATAVTQVAERGRQGWRRRSREQELAEVA
FT                   AELGAGAGAWTVHDRRGAATREADRAGAAGERRGLLGRRDGDGAGGRRGLFRGRDAGDE
FT                   RFEDVDGRAVAPGQRRMRSPLLLGHALPGLAGGAVVAVGLSVVPVAADVTVPSPLLAGA
FT                   LAAVAVGLLPRIGWLACVAVLLSWLAGPAGAPGTALVVAAGVAVIPPLLPFGGRSWSLP
FT                   FAAPLLGAAMLAGAYPAVAGQARTVWRRAALGALGFWLLALAEPLARTTLFYGRARGTQ
FT                   PLPRWDDSLDGAIDHALRPLLESGMLATAALWAAGAAVLPWLVRGRRAAIDLIAATLWA
FT                   AALAAGASAIGGTLDGRVPHPDPRGAALGAAAAVFVAIAARAVRAARARRHDENDVPRA
FT                   GGGVVAAPGVGRRRWPAADPEALP"
     gtggaacacc gcaacgtgac cggcggcgac gcatcgaccg tgcgcctgcg cggcgaaggg        60
     ccgcgtccgc cggacgcggc gccgctcgtg ctcgagcgct accggctgct gcgccaactc       120
     ggcgcgggcg cgttcggcac tgtctggctc gcgcacgacg agcggctcgc ccgcgacgtc       180
     gccgtcaagg cgatcgcgct cgaccacgcc tccggccgcg ccgagcagga ggcgcgtgcc       240
     gccgcacggc tcgcccaccc ggcgatcgtg acgctctacg aggcgggcac ggaggacggc       300
     agcacctatc tcgtcaccga gctggtccgc ggcggcacgc tcgcggagct gctggcggag       360
     ggcgcgctgt cggaccgcga cgtcgccgag gtcgggatcg cgctctgcca ggggctggcc       420
     cacgcccatg cgcaaggcgt cgtgcaccgc gacgtgaagc cgtcgaacgt gctcgtgccg       480
     gacgccccgc acgccggcgg accggtcgcg aagctgaccg acttcggcgt cgcgcggatc       540
     gtcgagggcg ccggcggcga cgcgctgacg cgcacgggcg acgtcgtcgg cacgctcgcg       600
     tacatggcgc ccgagcaggc ggaggggaga gaggccggcg cgcccgccga cctctacgcc       660
     gccgcgctcg tgctctacga ggcgctcagc ggcgtcaacc cgattcgtgg cgggacggcg       720
     gtcgcgaccg cgcgccggct cggcgcgacg ctgccgccgc tggagcgcca gcggcgcgat       780
     ctgccgcccg atctgtgcga cgcgatcgac cgcgcgctgc tgccgcggcc cggcgagcgc       840
     ggcaccgtcg cgcacctgca ccgcgcgctg agagcggcgc tgccgcagct cggcgacgag       900
     cccgggaccg tcgaggcacc gcacgtcgag cggttcgcga cggcggtgac gcaggtcgcc       960
     gagcgcggcc ggcagggctg gcgccgccgc tcgcgcgagc aggagctggc cgaggtcgcc      1020
     gccgagctgg gcgccggagc gggcgcgtgg acggtgcacg accgccgtgg ggcggcgacg      1080
     cgcgaggcgg accgcgcggg cgctgcaggc gagcggcgtg ggctgcttgg ccgtcgcgat      1140
     ggggacggcg ccggcgggcg acgcgggctg tttcgcggcc gtgacgcggg cgacgagcgc      1200
     ttcgaggacg tggacggccg tgctgtggcc ccgggccagc ggcggatgcg ctcgccgctg      1260
     ctgctcggcc atgcgctgcc gggcctcgcc ggcggcgcgg tcgtcgccgt cgggctctcg      1320
     gtcgtgccgg tcgctgccga cgtgacggtg ccgagcccgc tgctcgccgg cgcgctggcg      1380
     gcggtcgcgg tcgggctgct gccgcggatc ggctggctcg cctgcgtggc ggtgctgctg      1440
     agctggctcg cgggaccggc cggcgcgccc ggcacggcgc tcgtcgtcgc cgccggcgtc      1500
     gctgtgatcc cgccgctgct gcccttcggc ggccgcagct ggtcgctgcc gttcgcggcg      1560
     ccgctgctcg gcgccgcgat gctcgccggc gcctatcccg cggtcgccgg gcaggcgcgc      1620
     accgtctggc gccgcgccgc gctcggcgcg ctcggcttct ggctgctggc gctcgccgag      1680
     ccgctggcgc gcacgacgct gttctacggc cgtgcgagag ggacgcagcc gctgccgcgc      1740
     tgggacgact cgctcgacgg cgcgatcgac catgcgctgc gcccgctgtt ggagtcgggg      1800
     atgctcgcga ccgccgcgct gtgggccgcc ggcgcggcgg tgctgccgtg gctcgtgcgc      1860
     ggccgccgcg ccgcgatcga cctgatcgcc gcgacgctgt gggcagccgc gctggccgcc      1920
     ggcgcgtccg cgatcggcgg cacgctcgac gggcgcgtgc cgcatcccga cccccgtggc      1980
     gcggcgctcg gcgccgccgc tgccgtcttc gtcgcgatag ccgcccgcgc ggttcgtgcc      2040
     gctcgcgcgc gccgtcacga cgagaacgac gtgccgcggg ccggcggcgg ggtcgtcgcg      2100
     gcccccggcg tgggccggcg acggtggccg gcagccgatc cagaggcact gccgtag         2157
//

If you have problems or comments...

PBIL Back to PBIL home page