(data stored in ACNUC7421 zone)

EMBL: CP001854.PE110

CP001854.PE110       Location/Qualifiers
FT   CDS_pept        107536..108315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0110"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   vap:Vapar_1509 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48546"
FT                   /db_xref="GOA:D3F4W8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB48546.1"
FT                   /translation="MDTASESPGASSRRRALVTGASSGIGAAAAAALAAGGCDVWLTYA
FT                   RDEQGAAATADEVRRHGAEAHVSRLDLGDAGAIERLLDEVAGRWGELNVLVNNGGVCPY
FT                   TPADEISVAEWDAVLETNARGTFLALRGALPLLRAAAGDRSVVNVSSVAGELGGVATSV
FT                   HYAASKAAILAITRSYARLLAAEGIRVNAVAPGPVRSGITGKLSDEAAAGLTGATPLGR
FT                   FGQPHEVASAIALLASPAAGFTTGATYDVNGGVRIDG"
     atggacactg cttctgaatc tccgggtgct tcgtcccgcc gccgcgcgct cgtgactggc        60
     gccagctccg gcatcggcgc cgccgccgcc gccgcgctcg ccgcgggcgg ctgcgacgtc       120
     tggctcacct acgcgcgcga cgagcagggc gccgccgcca cggccgacga ggtccggcgc       180
     cacggcgccg aggcccacgt ctcgcggctc gacctcggcg acgccggcgc gatcgagcgc       240
     ctgctggacg aggtcgccgg acggtggggc gagctgaacg tgctcgtcaa caacggcggc       300
     gtctgcccgt acacgcccgc ggacgagatc tccgtcgcgg agtgggacgc ggtgctggag       360
     accaacgcgc gcggcacctt cctcgcgctg cgcggcgcgc tcccgctgct gcgcgcagca       420
     gccggcgacc gctcggtcgt caacgtctcg tccgtcgccg gcgagctggg cggcgtcgcg       480
     acgtcggtcc actacgccgc cagcaaggcg gcgatcctcg cgatcacgcg ctcctacgcg       540
     cgcctgctcg cggccgaggg catccgtgtc aacgccgtcg ctcccggccc ggtccgcagc       600
     ggcatcaccg gcaagctctc cgacgaggcg gccgccggcc tgaccggtgc gacgccgctc       660
     ggccgtttcg gccagccgca cgaggtcgcc tcggcgatcg cgctgctggc ctcgccggcc       720
     gccggcttca cgaccggcgc cacctatgac gtcaacggag gggtgcggat cgatggctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page