(data stored in ACNUC7421 zone)

EMBL: CP001854.PE111

CP001854.PE111       Location/Qualifiers
FT   CDS_pept        108308..108658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0111"
FT                   /product="steroid delta-isomerase domain-containing
FT                   protein"
FT                   /note="KEGG: pfl:PFL_4892 steroid delta-isomerase domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48547"
FT                   /db_xref="GOA:D3F4W9"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W9"
FT                   /inference="similar to AA sequence:KEGG:PFL_4892"
FT                   /protein_id="ADB48547.1"
FT                   /translation="MADAEQVFRAQVDAFNARDLDAFLGTYAPDAALHGLLPDRVVNGH
FT                   DEMREIYAARFRQDPLHCTIHATTVYGDRWVAAHERVLGPSGTVELVGVFEVVDGRIVR
FT                   ADMTGRIPVSGD"
     atggctgacg ccgagcaggt cttccgtgcg caggtcgacg cgttcaacgc gcgcgacctc        60
     gacgcgttcc tggggaccta cgcgcccgac gccgcgctgc acgggctgct gcccgaccgc       120
     gtcgtcaacg ggcacgacga gatgcgcgag atctacgccg cgcgcttccg gcaggacccg       180
     ctgcattgca cgatccacgc gacgacggtc tacggcgacc gctgggtcgc cgcccacgag       240
     cgcgtcctcg gcccgagcgg cacggtcgag ctggtcggcg tgttcgaggt cgtcgacggc       300
     cgtatcgtgc gggccgacat gacaggacgg atcccggtct ccggcgattg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page