(data stored in ACNUC7421 zone)

EMBL: CP001854.PE112

CP001854.PE112       Location/Qualifiers
FT   CDS_pept        108727..110301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0112"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: oan:Oant_1288 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48548"
FT                   /db_xref="GOA:D3F4X0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X0"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADB48548.1"
FT                   /translation="MRWKRTVAAATVACALAVAGCGGDSSSTSGDSGGDTSTGDTPAQV
FT                   AQGGTLTVAHTDGIPQLNPVIRTFGWEEVLFPLLWNGLSKADENGDVVPDIARSWSASP
FT                   DQRTWTFELRTDVRYSNGRPLTSRNVVKAFEYYLDPRTTTQEANKIATIASVRADGPAR
FT                   VVVQLREPNALFPEAIVWVKIVDVDNVGQIDKRPVVTGPYTVKDFVPDDHVTLVPNPEY
FT                   WGDPAPLREMEIVKATDTTSALGALRAGDIDVIWATNPTDVASLEGDPDLKTVEPEVPS
FT                   KYVDWEFDTTAPPFDNVKARQAVAYAVDREAVLQSAYYGLGDLAPTNNPLSTNNPYYGG
FT                   ELTDYSYDLDKARALFEEAGIRAGDTITWWGTAGTNAEWTTAAEIVQASLREIGIELKI
FT                   ENREISTWADKFYPAGKRFPNFLVPNLASFPPSPADAFGFYRRGRCECNWDNPEFESAY
FT                   DAALAEPDETKAKEKWATVQEIVNREVPLIIPLQVKVVSSMRSNVEGVWMEGGGQLHLE
FT                   QAGVAAE"
     atgaggtgga agaggacagt tgcggcggcg acggtcgcgt gtgcgctcgc cgtcgcgggc        60
     tgcggtggtg acagcagcag cacgtcgggc gactccggcg gcgacacgtc caccggcgac       120
     acgccggcgc aggtcgcgca gggcggaacg ctcaccgtcg cccatacgga cggcatcccg       180
     cagctgaacc cggtgatccg gacgttcggc tgggaagaag tgctcttccc gctgctgtgg       240
     aacgggctct cgaaggccga cgagaacggc gacgtcgtcc ccgacatcgc cagatcgtgg       300
     agcgcctcgc ccgatcagag aacgtggacg ttcgagctgc ggaccgacgt cagatactcc       360
     aacggcagac cgctcacgtc gagaaacgtc gtgaaggcgt tcgagtacta cctcgacccc       420
     agaacgacga cgcaggaggc gaacaagatc gccacgatcg cgagcgtcag agcggacggg       480
     cccgcgagag tcgtcgtgca gctgagagag ccgaacgcgc tcttccccga ggcgatcgtg       540
     tgggtcaaga tcgtcgacgt cgacaacgtc ggccagatcg acaagagacc ggtcgtgacc       600
     ggtccgtaca ccgtgaagga cttcgtcccg gacgaccacg tcacgctcgt ccccaacccc       660
     gagtactggg gcgacccggc gccgctgaga gagatggaga tcgtcaaggc gaccgacacg       720
     acctccgcgc tcggcgcgct gcgcgccggc gacatcgacg tgatctgggc gaccaacccg       780
     accgacgtcg cctcgctgga gggcgatccc gacctcaaga cggtcgagcc ggaggtgccg       840
     agcaagtacg tcgactggga gttcgacacg accgcgccgc cgttcgacaa cgtcaaggcg       900
     cggcaggccg tcgcctacgc cgtcgaccgc gaggccgtgc tgcagagcgc ctactacggc       960
     ctcggcgacc tcgccccgac gaacaacccg ctcagcacga acaacccgta ctacggcggc      1020
     gagctgaccg actacagcta cgacctcgac aaggccagag cgctgttcga ggaggccggc      1080
     atcagagccg gcgacacgat cacctggtgg ggcaccgccg gcacgaacgc cgagtggacg      1140
     accgccgccg agatcgtgca ggcgagcctg agagagatcg gcatcgagct gaagatcgag      1200
     aaccgcgaga tctccacctg ggccgacaag ttctacccgg ccggcaagag attcccgaac      1260
     ttcctcgtgc cgaacctcgc ctcgttcccg ccctcgccgg ccgacgcctt cggcttctac      1320
     cgcagaggcc gctgcgagtg caactgggac aacccggagt tcgagagcgc ctacgacgcc      1380
     gctctcgccg agcccgacga gacgaaggcg aaggagaagt gggcgacggt gcaggagatc      1440
     gtcaacagag aggtcccgct gatcatcccg ctgcaggtca aggtggtgtc gtccatgcgg      1500
     tccaacgtcg aaggcgtctg gatggagggc ggcggccagc tgcacctcga gcaggcgggc      1560
     gtcgccgcgg agtag                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page