(data stored in ACNUC7421 zone)

EMBL: CP001854.PE113

CP001854.PE113       Location/Qualifiers
FT   CDS_pept        110307..111269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0113"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mes:Meso_1505
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48549"
FT                   /db_xref="GOA:D3F4X1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48549.1"
FT                   /translation="MLGFVIRRAATSILMLVAASVLVFVILRLLPGDPIITRLGATAGA
FT                   NPEAIDQLRREAGLEDPILQQYFDWVGGVLSGDFGQSYFSQFSVTELISRRIGATLELT
FT                   GVAIFFSLLIAVPAAVFCSLRRGSWFDRLVTTGSTVGMALPQFLLGILLILVFAVELRW
FT                   LPARGYVPFNEDPAENVKRMILPALTLAIAAAPLILRYLRASMIEVLDSSYIRTAEGKG
FT                   VPHRRVVVSHALRNALIPGLTMLGMIVGYTLGGVVIVEYVFGIPGLGSLAVESVFKRDY
FT                   AVLQSVVLLISALFIFTTLVVDVLYGVLDPRLRGGGAHG"
     gtgctcgggt tcgtcatccg gcgggcggcg accagcatcc tgatgctggt cgccgcatcc        60
     gtcctcgtct tcgtgatcct ccgcctgctg ccgggggatc cgatcatcac gcgcctcggc       120
     gcgaccgccg gggcgaaccc ggaggcgatc gaccagctcc gccgcgaggc ggggctggaa       180
     gatcccatcc tgcagcagta cttcgactgg gtcgggggcg tcctgagcgg cgacttcggc       240
     cagtcgtact tcagccagtt ctccgtcacc gagctgatca gccgccggat cggcgcgacg       300
     ctcgagctga ccggagtggc gatcttcttc tcgctgctga tcgcagtgcc ggccgccgtc       360
     ttctgctcgc tgcgacgcgg cagctggttc gaccgcctcg tcacgaccgg ctcgacggtc       420
     ggcatggcgc tgccgcagtt cctgctcggg atcctgctga tcctcgtctt cgccgtcgag       480
     ctgcgctggc tgccggcgcg cggatacgtc ccgttcaacg aggacccggc cgagaacgtc       540
     aagcggatga tcctgcccgc gttgacgctc gcgatcgcgg cggcgccgtt gatcctgcgc       600
     tacctgcgtg cctcgatgat cgaggtgctc gactcgtcct acatccgcac cgcggagggg       660
     aagggcgtgc cgcaccgccg cgtcgtcgtc tcacacgcgc tccgcaacgc gctgatcccg       720
     gggctgacga tgctcggcat gatcgtcggc tacacgctcg gcggcgtcgt gatcgtcgag       780
     tacgtcttcg gcatccccgg cctcggctcg ctcgcggtcg agtcggtctt caagcgcgac       840
     tacgcggtcc tgcagtcggt cgtgctgctg atcagcgcgc tgttcatctt caccacgctc       900
     gtcgtcgacg tgctctacgg cgtgctcgat ccccgcctgc gcggcggagg cgcacatggc       960
     tag                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page